DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-3 and Drice

DIOPT Version :8

Sequence 1:NP_001255708.1 Gene:ced-3 / 178272 WormBaseID:WBGene00000417 Length:503 Species:Caenorhabditis elegans
Sequence 2:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster

Alignment Length:375 Identity:113/376 (30%)
Similarity:167/376 (44%) Gaps:81/376 (22%)


 Worm   129 HRDSVSSVSSFTSYQDIYSRARSRSRSRALHSSDRHNYSSPPVNAFPSQPSSANSSFTGCSSLGY 193
            |.|::.||.|            ..:.|..|.:...|.|.|..:...      ||         ||
  Fly    26 HTDALGSVGS------------GGAGSSGLVAGSSHPYGSGAIGQL------AN---------GY 63

 Worm   194 SSSRNRSFSKASGPTQYIFHEEDMNFVDAPTISRVFDEKTMYRNFSSPRGMCLIINNEHFEQMPT 258
            ||. :.|:.|              |.....|.....:....::|    |||.||.|:|||| :||
  Fly    64 SSP-SSSYRK--------------NVAKMVTDRHAAEYNMRHKN----RGMALIFNHEHFE-VPT 108

 Worm   259 ---RNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLTIRDFAKHESHGDS-AILV-ILSHGEE 318
               |.||..|.:|||.:.:.:.:.|....:...:.:|.|| ::|..::|.|| .||| ||||||.
  Fly   109 LKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTI-EYAASQNHSDSDCILVAILSHGEM 172

 Worm   319 NVIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQACRGERRDNGFPVLDSVDGVPAFLRRG 383
            ..|. ..|.......|:....|.:.|.||.|||:.|:|||:|:|.|.|           ..::|.
  Fly   173 GYIY-AKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGG-----------VTMQRS 225

 Worm   384 WDNRDGPLFNFLGCVRPQVQQVWRKKPSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTH 448
            ....||.            ..:..|.|..||.||||:|...:.||||:.|||||:|::|...:.:
  Fly   226 QTETDGD------------SSMSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAAN 278

 Worm   449 AKDMDVVELLTEVNKKVACGFQT----SQGSNILKQMPEMTSRLLKKFYF 494
            .|.:|::.|||.|.::||..|::    :...:..||:|.:|:.|.:...|
  Fly   279 GKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRILRF 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ced-3NP_001255708.1 CARD 2..90 CDD:128424
CASc 235..496 CDD:214521 93/270 (34%)
DriceNP_524551.2 CASc 86..330 CDD:214521 93/274 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C105477793
eggNOG 1 0.900 E1_KOG3573
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I3144
Isobase 1 0.950 0 Normalized mean entropy S5027
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000511
OrthoInspector 1 1.000 T97980
orthoMCL 1 0.900 OOG5_130238
Panther 1 1.100 O PTHR10454
Phylome 1 0.910 0.947 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3066
TreeFam 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.