DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-3 and Dredd

DIOPT Version :8

Sequence 1:NP_001255708.1 Gene:ced-3 / 178272 WormBaseID:WBGene00000417 Length:503 Species:Caenorhabditis elegans
Sequence 2:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster

Alignment Length:286 Identity:73/287 (25%)
Similarity:114/287 (40%) Gaps:84/287 (29%)


 Worm   243 GMCLIINNEHF--------------EQMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLL 293
            |:.||||.:.|              :.:..|:||..||:.|..:|..|||.|...||:...|::.
  Fly   259 GIALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIE 323

 Worm   294 TIRDFAKHESHGDSAILVILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQAC 358
            .||.........||.::.|||||.|..:...:.|.:...:|.|||  .:...|..|||::.:|||
  Fly   324 RIRSACDRSLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLL--CSYDTLYYKPKLLIIQAC 386

 Worm   359 RGERRDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQQVWRKKPSQ----------- 412
                                                      |.:.|.:|||::           
  Fly   387 ------------------------------------------QEKLVHKKKPNELFRIDVTTVSP 409

 Worm   413 ---ADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLT----EVNKKVACGFQ 470
               .|:|.|.:|...|.:.|::..|||||.::|:.....:....:.::||    ||:||      
  Fly   410 DQHIDMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTNEVSKK------ 468

 Worm   471 TSQGSNILKQMPEMTSRLLKKFYFWP 496
              :|||....:|.:.|...:..||.|
  Fly   469 --RGSNDESMVPNVKSTFRQHVYFPP 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ced-3NP_001255708.1 CARD 2..90 CDD:128424
CASc 235..496 CDD:214521 72/285 (25%)
DreddNP_477249.3 CASc 252..492 CDD:294037 72/285 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104635374
eggNOG 1 0.900 E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.872 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.