DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rbm-17 and Spf45

Sequence 1:NP_502198.1 Gene:rbm-17 WormBaseID:WBGene00010233 Length:371 Species:Caenorhabditis elegans
Sequence 2:NP_001036426.1 Gene:Spf45 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster

Alignment Length:413 Identity:117/414 (28%)
Similarity:169/414 (41%) Gaps:128/414 (31%)


 Worm    41 LQQQAARQKLVKSSAPPPVIDLSTR---NRTIT-----TAVTSKSFQPIRANPVSDNISFLPKAA 97
            ||.|.|.:..||.....||::|.::   :..:|     |.|.||.....:|.|     |.|.:..
  Fly    26 LQTQLAVKMAVKKPLMTPVVNLRSKRLADPEVTCFAPITTVVSKPLISGKALP-----SILERIN 85

 Worm    98 TDESVMLFGEEHVKCEYYPMTPNNYEVVAKEINDRKQREKTAREVAKRLQREHEEEDKKRSK--- 159
            .       |:..|..||.|..||.||.:.::.|.   .:|....|:.|..|:.:|:|:||.:   
  Fly    86 R-------GDWDVADEYDPQRPNEYEKLKEKSNG---SDKNRAGVSDREDRDDKEKDRKRGRVGR 140

 Worm   160 ---------------------------------------GAAIAPPTMLMEPEPEVIKNTNENQD 185
                                                   ||.||||..|.|..   |.:..|..:
  Fly   141 REFYRDEVSAPNLKLSGFGHRQNDDDMYLPSPGLVAKQGGATIAPPPSLQEMS---IDSGCEATN 202

 Worm   186 EKPHSSFMPPPSFLPAFGKATSRGLGIAANIMKRHGYKEGAGLGKSEQGMSTALSIEKTGVRGGN 250
            ..|:|              |:|    :||.||.::|:|:|.|||||||||:.||.:|||..|||.
  Fly   203 TMPYS--------------ASS----VAAKIMAKYGFKDGQGLGKSEQGMAIALQVEKTSKRGGR 249

 Worm   251 IVAE-----------------------------APKAPTFATNS-------MEAVQNATKILQLW 279
            |:.|                             .|:....|..|       .|.:::.:|::.|.
  Fly   250 IIHEKDVFLPPLALSPPSIGSQIGTSPSHKAMPPPQMVDTAAESGDIGYSITEIMKSPSKVVLLR 314

 Worm   280 NLTDLSEVSGEEGKKEFADEIKEEME-KCGQVVNVIVHVDESQEEDRQVRVFVEFTNNAQAIKAF 343
            |:....:|.     :|...|:|:|.. |.|:|.:||:|.......:..|::||||.....||||.
  Fly   315 NMVGPGDVD-----EELEPEVKDECNTKYGEVNSVIIHESFGTVPEDAVKIFVEFRRIESAIKAV 374

 Worm   344 VMMNGRFFGGRSVSAGFQNVSDY 366
            |.:||||||||.|.|||.|...:
  Fly   375 VDLNGRFFGGRQVRAGFYNYDKF 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rbm-17NP_502198.1 G-patch 211..254 CDD:279867 25/43 (58%)
RRM_UHM_SPF45_PUF60 273..362 CDD:240820 36/90 (40%)
Spf45NP_001036426.1 G-patch 209..248 CDD:279867 24/43 (56%)
RRM_UHM_SPF45 307..402 CDD:241091 37/97 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231624698
eggNOG 1 0.900 E1_KOG1996
Hieranoid 1 1.000
Homologene 1 1.000 H13162
Inparanoid 1 1.050 118 1.000 Inparanoid score I3324
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1101846at2759
OrthoFinder 1 1.000 FOG0005792
OrthoInspector 1 1.000 T476985
orthoMCL 1 0.900 OOG5_129437
Panther 1 1.100 LDO PTHR13288
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3833
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.