DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Msn and Moe

Sequence 1:NP_034963.2 Gene:Msn MGIID:97167 Length:577 Species:Mus musculus
Sequence 2:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster

Alignment Length:646 Identity:357/647 (55%)
Similarity:458/647 (71%) Gaps:89/647 (14%)


Mouse     3 KTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKAFSTWLKLNKK--- 64
            ||::|||||||||||||||..||||||||||||||||||||||||||.|:|..|||:||.||   
  Fly    22 KTLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPES 86

Mouse    65 --------------------------------------------------VTAQDVRKESPLLFK 79
                                                              |..|||:||:||.|:
  Fly    87 PAIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKKENPLQFR 151

Mouse    80 FRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKS 144
            ||||||||||:||||||||.|||:||||..||.|:|||||||:|||||||||:::||.||..|.:
  Fly   152 FRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTA 216

Mouse   145 GYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIK 209
            |:||.|:||||||::|||::||:||:.|..|.:|||.||||||::|||||||||||||||||.|:
  Fly   217 GFLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIR 281

Mouse   210 NKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRL 274
            ||||::|||||||||||||||:|||||||||||||||||||::|||:|||||||||||:|:|||:
  Fly   282 NKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRV 346

Mouse   275 RINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERALLENEKKKRELAEKEKEK 339
            ||||||||||||||||||||||||||:||||||||||||:.||.||       :|.:||...:|:
  Fly   347 RINKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQER-------EKLQLALAARER 404

Mouse   340 IEREKEELMEKLKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALL 404
            .|::::|..::|||::|..:::|::|.|.......||::.|:.|:..::|...::|.    :|:|
  Fly   405 AEKKQQEYEDRLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQLQAAKDELELRQKEL----QAML 465

Mouse   405 QASRDQKKTQ--EQLASEMAELTARISQLEMARKKKESEAVEWQQKAQMVQEDLEKTR------- 460
            |...:.|..:  |:|..| .|:.|:  |:|:.|.:.|..|.:  ::.:.:|:::|..|       
  Fly   466 QRLEEAKNMEAVEKLKLE-EEIMAK--QMEVQRIQDEVNAKD--EETKRLQDEVEDARRKQVIAA 525

Mouse   461 ---AELKTAMSTP---HVAEPAENEHDEQDEN---GAEASAELRADAMAKDRSEEERTTEAEKNE 516
               |.|..|.:||   ||||. |||::|:..|   |.:.|.:|..|...||..|:.||. ||:||
  Fly   526 EAAAALLAASTTPQHHHVAED-ENENEEELTNGDAGGDVSRDLDTDEHIKDPIEDRRTL-AERNE 588

Mouse   517 RVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM 577
            |:...||||..:||.:|||:|:||||.||.||:|.|||||||||:||:||||:|:|:||:|
  Fly   589 RLHDQLKALKQDLAQSRDETKETANDKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MsnNP_034963.2 B41 7..206 CDD:214604 152/252 (60%)
FERM_N 9..71 CDD:286467 52/115 (45%)
FERM_M 91..206 CDD:278785 83/115 (72%)
[IL]-x-C-x-x-[DE] motif. {ECO:0000250|UniProtKB:P26038} 115..120 5/5 (100%)
FERM_C_ERM 200..296 CDD:270015 85/96 (89%)
ERM 348..577 CDD:279153 96/247 (39%)
TMPIT 383..>464 CDD:285135 22/93 (24%)
MoeNP_727290.1 B41 26..278 CDD:214604 152/252 (60%)
FERM_N 28..83 CDD:286467 47/55 (85%)
FERM_M 163..278 CDD:278785 83/115 (72%)
FERM_C_ERM 272..368 CDD:270015 85/96 (89%)
GBP_C <375..497 CDD:303769 46/136 (34%)
ERM 403..649 CDD:279153 99/257 (39%)
coiled coil 464..477 CDD:293879 3/13 (23%)
coiled coil 486..497 CDD:293879 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C72859561
eggNOG 1 0.900 E1_KOG3529
Hieranoid 1 1.000
Homologene 1 1.000 H1833
Inparanoid 1 1.050 686 1.000 Inparanoid score I694
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D281811at33208
OrthoFinder 1 1.000 FOG0001007
OrthoInspector 1 1.000 T615747
orthoMCL 1 0.900 OOG5_129438
Panther 1 1.100 O PTHR23281
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4666
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.