| Sequence 1: | NP_498655.1 | Gene: | ceh-13 / 176069 | WormBaseID: | WBGene00000437 | Length: | 202 | Species: | Caenorhabditis elegans |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
| Alignment Length: | 216 | Identity: | 54/216 - (25%) |
|---|---|---|---|
| Similarity: | 82/216 - (37%) | Gaps: | 70/216 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Worm 16 QDWPTTH---SYYPS----VPSSYSPLNHHPADIWAAHPSNYIMGNGHVSPPATASGLSPP---- 69
Worm 70 ----------------------------ASRSSNSSAELPTGVTASQHNTYKWMHTKRSQRPAAP 106
Worm 107 KKKVIDENGTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKK 171
Worm 172 REKEKAFLARNTWESNSPTSS 192 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ceh-13 | NP_498655.1 | Homeobox | 118..164 | CDD:278475 | 18/45 (40%) |
| ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
| Homeobox | 475..527 | CDD:278475 | 22/51 (43%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||