DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and C15

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster


Alignment Length:252 Identity:61/252 - (24%)
Similarity:85/252 - (33%) Gaps:92/252 - (36%)


- Green bases have known domain annotations that are detailed below.


 Worm     1 MSSTECYG---APPHNYYQDWPTTHSYYPSVPSSYSPLNHHPADIWAAHPSNYIMGNGHVSPPAT 62
            |....||.   .|.....|...|..|...::|.|.|.|...|.:....|.:|    |.|:     
  Fly    44 MDGGSCYDESETPLSESLQSEQTRSSSSENLPFSISRLLSKPFETSHHHHNN----NNHL----- 99

 Worm    63 ASGLSPPASRSSNSSAE------------------LPTGVTASQHNT----YKWMHTKRS----- 100
             ...||.:|.::|:|.|                  |.|.:..|.:.:    |.:.|...|     
  Fly   100 -LSSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAGGH 163

 Worm   101 ----------------------------------------------QRPAAPKKKVIDENGTNRT 119
                                                          |....||:|      ..||
  Fly   164 VLRVPPQRTPLTWALPPLHHAALAHQAVKDRLAAAFPIARRIGHPYQNRTPPKRK------KPRT 222

 Worm   120 NFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKREKEK 176
            :||..|:.||||.||..||:....|..:|..||:.:||||.||||||.|.:::..|:
  Fly   223 SFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 23/45 (51%)
C15NP_476873.2 COG5576 <196..315 CDD:227863 33/90 (37%)
Homeobox 220..273 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.