DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and lbe

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster


Alignment Length:183 Identity:59/183 - (32%)
Similarity:74/183 - (40%) Gaps:62/183 - (33%)


- Green bases have known domain annotations that are detailed below.


 Worm    61 ATASGLSPPASRSSNS-------------------------------SAELPTGVTASQHNT--- 91
            |:..|.|..:.|||:|                               |.|.|||...|..:|   
  Fly   258 ASEDGSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLD 322

 Worm    92 -YKWMHTKR-------------SQRPAAPKKKVIDENGTNRTNFTTHQLTELEKEFHTAKYVNRT 142
             ...|.||.             |.|| .||||     ..:||.||.||:.||||.|...||::..
  Fly   323 ALFQMTTKDFDESQDKSHLDIFSNRP-QPKKK-----RKSRTAFTNHQIFELEKRFLYQKYLSPA 381

 Worm   143 RRTEIASNLKLQEAQVKIWFQNRRMKEKKREKE--------KAFLARNTWESN 187
            .|.|||::|.|..|||..||||||.|:|:..:|        |.|.|..::..|
  Fly   382 DRDEIAASLGLSNAQVITWFQNRRAKQKRDIEELKKDFDSVKVFSAHKSFLEN 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 24/45 (53%)
lbeNP_524435.2 Homeobox 356..410 CDD:395001 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.