DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and lbl

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster


Alignment Length:161 Identity:51/161 - (31%)
Similarity:64/161 - (39%) Gaps:51/161 - (31%)


- Green bases have known domain annotations that are detailed below.


 Worm    61 ATASGLSPPASRSSNSSA------------------------------ELPTGVTASQHNT---- 91
            |:..|.|..:.|||:|:.                              |.|.|.:.|..:|    
  Fly   157 ASEDGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSGDTPLDA 221

 Worm    92 YKWMHTK---RSQRPAA---------PKKKVIDENGTNRTNFTTHQLTELEKEFHTAKYVNRTRR 144
            ...:.||   ..|.||.         ||||     ..:||.||..|:.||||.|...||::...|
  Fly   222 LFQLSTKNFDEEQDPATLNIFATRSNPKKK-----RKSRTAFTNQQIFELEKRFLYQKYLSPADR 281

 Worm   145 TEIASNLKLQEAQVKIWFQNRRMKEKKREKE 175
            .|||..|.|..|||..||||||.|.|:..:|
  Fly   282 DEIAGGLGLSNAQVITWFQNRRAKLKRDMEE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 23/45 (51%)
lblNP_001262805.1 COG5576 206..332 CDD:227863 43/112 (38%)
Homeobox 254..307 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.