DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mpo and cd

Sequence 1:NP_034954.2 Gene:Mpo MGIID:97137 Length:718 Species:Mus musculus
Sequence 2:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster

Alignment Length:730 Identity:244/731 (33%)
Similarity:341/731 (47%) Gaps:144/731 (20%)


Mouse    37 LSCMEEAKQLVDRAYKERRESIKRSLQSGSASPTELLFYFKQPVAGTRTAVRAADYLHVALDLLK 101
            ||...||::|..|.|.|.:.:|                                       |:.|
  Fly   156 LSTNPEARKLARRGYVENQATI---------------------------------------DIAK 181

Mouse   102 RKLQPLWPRPFNVTDVLTPAQLNLLSVSSGCAYQDV-------RVTCPPNDKYRTITGHCNNRRS 159
            |         ||.|.  .|.:.|:     |...:.|       |:.|..|.:||..||.|||::.
  Fly   182 R---------FNYTK--QPGRSNI-----GWGPKIVLPDPTVLRLECDFNARYRRSTGVCNNKQH 230

Mouse   160 P-TLGASNRAFVRWLPAEYEDGVSMPFGWTPGVNRNGFKVPLARQVSNAIVRFPNDQLTKDQERA 223
            | |.|||...:.|.:..:|.||::     .|.|:.:| ::|.|||||..|.|   .....|....
  Fly   231 PRTYGASMVPYRRMVSPDYADGIA-----APRVSHHG-RLPPARQVSLKIHR---SSYETDSNFT 286

Mouse   224 LMFMQWGQFLDHDITLTPEPATRFSFFTGLNCET--SCL-----QQPPCFPLKIPPNDPRIKNQK 281
            :|...:|||:|||||.|       |..|....|:  .|:     |.|.|:|:.|.|:||..|...
  Fly   287 VMLAVFGQFMDHDITAT-------SLTTSQEGESIDCCVAATREQHPECYPVDILPDDPYYKQYN 344

Mouse   282 -DCIPFFRSCPACTRNNITIRNQINALTSFVDASGVYGSEDPLARKLRNLTNQLGLLAINTRFQD 345
             .|:.|.||.||.| .....|.|:|..|:|:|||.|||:.:....:||:..|.    ::.....|
  Fly   345 ISCMNFVRSAPAPT-GRFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFING----SLRMFVTD 404

Mouse   346 NGRALMPFDSLHDDPCLLTNR--SARIP--CFLAGDMRSSEMPELTSMHTLFVREHNRLATQLKR 406
            :||.|:|..|...|.|   ||  ..|:.  ||.:||.|::|...|||||.|:.|.||.||.||:.
  Fly   405 DGRQLLPISSNPADGC---NRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQLQE 466

Mouse   407 LNPRWNGEKLYQEARKIVGAMVQIITYRDYLPLVLG----------PAAMKKYLPQYRSYNDSVD 461
            .||.|..|:||||||||:||.:..|||.::||::||          ||......|.  :|:..||
  Fly   467 QNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPD--TYDPEVD 529

Mouse   462 PRIANVF-TNAFRYGHTLIQPFMFRLNNQYRPTGPNPRVPLSKVFFASWRVVLEGGIDPILRGLM 525
            |.|||.| ..|||:.|||: |.:|.::   |.......:.|.|:.|..:.:..|.|||..|....
  Fly   530 PSIANCFAAAAFRFAHTLL-PGLFNIS---RDNSTPEAIELHKMLFNPFSLWAEHGIDHALMTAA 590

Mouse   526 ATPAKLNRQNQIVVD-----EIRERLFE-----QVMRIGLDLPALNMQRSRDHGLPGYNAWRRFC 580
            .||.       :.||     |:.::|||     :|...||||.:||:||.||||:|.|..:||.|
  Fly   591 NTPV-------MQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHC 648

Mouse   581 GLPQPSTVGELGTVLKN--LELARKLMAQYGTPNNIDIWMGGVSEPLEPNGRVGQLLACLIGTQF 643
            .||...|..|:...:.|  |:..|::   |.:|.::|::.|.:|||.......|.||:|::..||
  Fly   649 RLPTVDTWEEMSQAIDNATLDSIRQI---YESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQF 710

Mouse   644 RKLRDGDRFWWE---NPGVFSKQQRQALASISLPRIICDNT-GITTVSKNNIFMSNTYPRDFVSC 704
            .:|:.||..|:|   .|..|:|.|...:...||..|||.|: |||.|.::.:..........|.|
  Fly   711 LRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPHVDC 775

Mouse   705 NTLP--KLNLTSWKE 717
            ..|.  ..|...|.|
  Fly   776 QDLEGFHFNFEPWSE 790

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MpoNP_034954.2 myeloperoxidase_like 289..702 CDD:188656 162/444 (36%)
An_peroxidase 147..685 CDD:281139 215/578 (37%)
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 214/577 (37%)
peroxinectin_like 364..750 CDD:188655 153/409 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 310 1.000 Inparanoid score I2565
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.