DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Meox1 and Antp

Sequence 1:NP_034921.1 Gene:Meox1 MGIID:103220 Length:253 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:312 Identity:79/313 (25%)
Similarity:110/313 (35%) Gaps:89/313 (28%)


Mouse    10 RNPQPPAPVWGCLRNPHSEDSSASGLSHYPPTPFSFHQKSDFPATAAYPDFSASCLAATPHSLPR 74
            |...|.:.|.|.:  |.::.:...|:      |....|:...|:.......:..........||:
  Fly    85 RPDSPSSQVGGVM--PQAQTNGQLGV------PQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQ 141

Mouse    75 -TERIFNEQHPAFPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTAG----------- 127
             |:::   .||...|..    |:..|..:|.....|.......|||.|||..:|           
  Fly   142 VTQQV---THPQQQQQQ----PVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPH 199

Mouse   128 -LGEDCMVLG----TIANETEKKSSRRKKERSDNQ--------------ENGGGKPE-------- 165
             :|.....||    .:.:.||...:.........|              ..|.|.|:        
  Fly   200 HMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQ 264

Mouse   166 ---------------------------GSSKARKE-RTAFTKEQLRELEAEFAHHNYLTRLRRYE 202
                                       |..:.||. |..:|:.|..|||.||..:.||||.||.|
  Fly   265 HTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIE 329

Mouse   203 IAVNLDLSERQVKVWFQNRRMKWKRVK--GGQPVSPQEQDREDGDSAASPSS 252
            ||..|.|:|||:|:||||||||||:..  .|:|.|..|     ||....|:|
  Fly   330 IAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGE-----GDEITPPNS 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Meox1NP_034921.1 Abdominal-A 139..253 CDD:332641 50/167 (30%)
Homeobox 174..226 CDD:306543 32/52 (62%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.