DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Meox1 and zen2

Sequence 1:NP_034921.1 Gene:Meox1 MGIID:103220 Length:253 Species:Mus musculus
Sequence 2:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster

Alignment Length:61 Identity:36/62 (58%)
Similarity:45/62 (73%) Gaps:0/62 (0%)


Mouse   167 SSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKR 227
            |.|:::.||||:..||.|||.||..:.||.|.||.||:..|.|:|||||:||||||||.|:
  Fly    40 SEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK 100

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Meox1NP_034921.1 Abdominal-A 139..253 CDD:332641 36/62 (58%)
Homeobox 174..226 CDD:306543 33/52 (63%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.