DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Man2b1 and LManIII

Sequence 1:XP_006530810.1 Gene:Man2b1 MGIID:107286 Length:1024 Species:Mus musculus
Sequence 2:NP_001285762.1 Gene:LManIII FlyBaseID:FBgn0032066 Length:1003 Species:Drosophila melanogaster

Alignment Length:1036 Identity:408/1037 (39%)
Similarity:585/1037 (56%) Gaps:126/1037 (12%)


Mouse    47 ARAAGYKTCPPTKPGMLNVHLLPHTHDDVGWLKTVDQYYYGMDLDFLNFMPTVLSDVQHASVQYI 111
            :.|..|::||.||..|:|:||:||:|||:||||||||||||..           .::|||.||||
  Fly    21 SEAVCYESCPETKSNMINIHLVPHSHDDLGWLKTVDQYYYGNK-----------HNIQHAGVQYI 74

Mouse   112 LDSVVSSLLEKPTRRFIYVEMAFFSRWWKQQTSATQDAVRNLVRQGRLEFVNGGWVMNDEAATHY 176
            .|:||:.|.:...||||.||..||::||:.|:...:..|:.||.:|||||..|.|.||||||.:|
  Fly    75 FDTVVAELSKDSRRRFIQVETGFFAKWWEDQSETKKKLVKTLVNEGRLEFTGGAWSMNDEAAVNY 139

Mouse   177 GAIVDQMTLGLRFLQDTFGSDGLPRVAWHIDPFGHSREQASLFAQMGFDGFFLGRIDYQDKLNRK 241
            .:::||..:||:||.|.||..|.|||.|.||.|||||||||:||||.|||.|..|:|..||..|.
  Fly   140 QSVIDQFAVGLKFLNDNFGVCGRPRVGWQIDAFGHSREQASMFAQMAFDGQFFARMDQNDKNKRV 204

Mouse   242 KKLRMEELWRASDSLEPPAADLFTGVLPNNYNPPKYLCWDVLCTDPPVVDNPRSPEFNAKTLVNY 306
            ..|.:|.:|.||::||  ..|.|||:|.|:|:.|...|:|.||.|.|::|. :|.:.|.|:.|:.
  Fly   205 DNLGLEMVWDASETLE--EMDFFTGMLYNHYSAPPGFCFDSLCQDDPIIDG-KSYDNNVKSRVDD 266

Mouse   307 FLKLASSQKGFYRTNHTVMTMGSDFHYENANMWFKNMDKLIRLVNAQQVNGSLVHVLYSTPTCYL 371
            ||..||:..|:||:||.::.||.||.||||.|.:|||||||:.||.:|.:||..::.|||..|||
  Fly   267 FLNYASNLAGYYRSNHIMVPMGDDFQYENAYMNYKNMDKLIKYVNERQASGSKYNIFYSTAGCYL 331

Mouse   372 WELNKANLTWTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQVCNQLEALV---GPE 433
            ..|:|:..::..|..||.|::.....||||:|:|||..||:||...:.|||..||..|.   |.|
  Fly   332 NSLHKSLQSFPNKTQDFLPHSHEAKSFWTGFFTSRPTQKRFERDGNHILQVAKQLSVLADLSGEE 396

Mouse   434 ANVGPYGSGDSAPLQEAMAVLQHHDAVSGTARQNVVNDYARQL-AAGWGPCEVLVSNALARLSHY 497
            .:      .|...|::.|||:|||||::||.:|.|.|||.|.| .|..|.... ..:||..|::.
  Fly   397 QH------KDLDYLRQIMAVMQHHDAITGTEKQEVSNDYDRLLYDAILGGANT-ARDALRVLTNQ 454

Mouse   498 KQ-NFSFCRELNISICP-VSQTSERFQVTLYNPLGRKVDQMVRLPVYEGNFIVKDPHDKNISSNV 560
            .. .|..|.:||||.|. ..:.::.|.|||||||.....|.||:||.|.::.|.|.....::|.:
  Fly   455 PNGEFQSCLKLNISECAFTKENADDFMVTLYNPLAHTSTQYVRVPVKEDSYQVTDEKGGLVASEL 519

Mouse   561 VMVP------SYYSETYQWELLFPASVPALGFSTYSVAKM---------------SDLNHQAHNL 604
            |.||      .:.:...|.||:|.|||..:  :||.:.|:               ..:|.:..| 
  Fly   520 VPVPWEVLSLEFRNNDTQHELVFKASVNKI--ATYFIKKIDKTTEVDITVNTQTEQSVNEEESN- 581

Mouse   605 LSRPRKHKSHHVL------------VIENKYMRATFDSGTGLLMKIENLEQN-LSLPVSQGFFWY 656
            :..|::.|..|.|            :::|..::...|:.||   :::.:|.| :|..:.|.|..|
  Fly   582 VKVPKRFKKVHSLKTDLETLDDQETIVQNSLIKLVIDNNTG---RLKTVEMNGVSEDIDQTFGMY 643

Mouse   657 NASVGDEESSQASGAYIFRPNVGKPIPVSRWAQISLVKTAL---------VQEVHQNFSAWCSQV 712
            ..:        .|..||||.:          |.:.||:.|.         |:||||:.:.|.|||
  Fly   644 KTA--------RSCHYIFRQD----------ADLELVEDAFDFTVYDGESVKEVHQHVNEWISQV 690

Mouse   713 IRLYKGQRHLELEWTVGPIPVRDDWGKEVISRFDTPMKTKGQFFTDSNGREILKRRDDYRPTWTL 777
            ||:|:|...:|.||.|||:|:.|:.|||:::.|.:.:.:.|.|:|||||||:::|..|.|..::.
  Fly   691 IRIYEGVNRVEFEWLVGPVPIDDELGKEIVTIFKSGISSGGVFYTDSNGREMMRREKDKREDFSP 755

Mouse   778 NQTE-PVAGNYYPVNTRIYITDGQMQLTVLTDRSQGGSSLQDGSLELMVHRRLLVDDDRGVSEPL 841
            :.:| ||:||||||.:|:.:.|...::.:|.||||||:||:||.||:|:|||.:..|..|.:|.:
  Fly   756 DLSEQPVSGNYYPVTSRMALQDSSKRMVLLNDRSQGGASLEDGRLEMMLHRRHIFADGSGAAEAI 820

Mouse   842 LETDTGDKV--RGRHLVLLSSVSDAAARHRLLAEQEVLAPQVVLSLGGSSPYHSRATPKT--QFS 902
            .|...|..:  ||:..:.|:::.|.|.....:||:|:..| .......|:...|..| ||  .|:
  Fly   821 NEQQFGKGLIARGKLFLYLNAIEDGATASERVAEKEIHLP-FWKFFSKSNNIQSDVT-KTLSDFN 883

Mouse   903 GLRQELPPQVHLLTLARWGPKMLLLRLEHQFALKEDSDRNLSSPVTLNVQNLFQTFTINYLQETT 967
                :||..||||||..:....:|||||:..      |:...:.|:.:::.:|.......::|||
  Fly   884 ----DLPQSVHLLTLEPYSKDEILLRLENFL------DQTEGNVVSFSIRQIFDDLGGLEIRETT 938

Mouse   968 LAANQPLSRASRLKW-MTNTGP--------TSYPEPSKLDPT------SVTLKPMEIRTFL 1013
            |..|.|||...|||: ...:||        ||..:|...|.|      |||||||:||||:
  Fly   939 LDGNLPLSDMKRLKFHHDGSGPSHSVPEYFTSLHKPLAADKTQDASEFSVTLKPMQIRTFI 999

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Man2b1XP_006530810.1 GH38N_AMII_LAM_like 63..352 CDD:212121 150/289 (52%)
Alpha-mann_mid 398..476 CDD:214875 38/81 (47%)
Glyco_hydro_38C 521..1012 CDD:285047 184/554 (33%)
LManIIINP_001285762.1 GH38N_AMII_LAM_like 37..311 CDD:212121 149/288 (52%)
Alpha-mann_mid 358..433 CDD:286360 38/81 (47%)
Glyco_hydro_38C 603..998 CDD:285047 148/428 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64844318
eggNOG 1 0.900 E1_KOG1959
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4230
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 1 1.000 T616153
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.750

Return to query results.
Submit another query.