DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56c and Obp99a

DIOPT Version :10

Sequence 1:NP_995902.1 Gene:Obp56c / 170882 FlyBaseID:FBgn0046879 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_651707.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster


Alignment Length:69 Identity:19/69 - (27%)
Similarity:28/69 - (40%) Gaps:11/69 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 QCFVSCLYETLDL----DRYNVLLEEAFKNQVQTIIQHEK---AEIKECSDL--QGKTRCEAAYK 190
            ||::.|::....|    ..:||  |...:..|.....|.:   |.:..|.|.  ||...||.||:
  Fly    59 QCYIKCVFTKWGLFDVQSGFNV--ENIHQQLVGNHADHNEAFHASLAACVDKNEQGSNACEWAYR 121

  Fly   191 LHLC 194
            ...|
  Fly   122 GATC 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56cNP_995902.1 PBP_GOBP <131..195 CDD:467938 19/69 (28%)
Obp99aNP_651707.1 PhBP 29..130 CDD:214783 19/69 (28%)

Return to query results.
Submit another query.