DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83g and Obp83cd

DIOPT Version :10

Sequence 1:NP_731043.1 Gene:Obp83g / 170878 FlyBaseID:FBgn0046875 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster


Alignment Length:105 Identity:24/105 - (22%)
Similarity:47/105 - (44%) Gaps:16/105 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AEKAFEECREDYYVPDDIYEKYLNYE-FPAHRRTSCFVKCFLEKLELFSEKKGFDERAMIAQ--- 93
            |:.|.::|.:|  |..|.::.:..:. :|.:....||.:||::||.:|.||....:...:.|   
  Fly   146 AKDAMKDCLQD--VHQDEWKSFDAFAYYPVNEPIPCFTRCFVDKLHIFEEKTRLWKLEAMKQNLG 208

  Fly    94 FTSKSSKDLSTVQHGLEKCIDHNEAESDVCTWANRVFSCW 133
            ..:|.::        :..|  |.....|.|....:.|:|:
  Fly   209 IPAKGAR--------IRTC--HRHRGRDRCATYYKQFTCY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83gNP_731043.1 PBP_GOBP 25..134 CDD:460193 24/105 (23%)
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783
PhBP 149..242 CDD:214783 23/102 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.