powered by:
Protein Alignment Obp83g and Obp56b
DIOPT Version :8
Sequence 1: | NP_731043.1 |
Gene: | Obp83g / 170878 |
FlyBaseID: | FBgn0046875 |
Length: | 146 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611443.1 |
Gene: | Obp56b / 37265 |
FlyBaseID: | FBgn0046880 |
Length: | 137 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 16/68 (24%) |
Similarity: | 25/68 (37%) |
Gaps: | 21/68 (31%) |
Fly 67 CFVKCFLEKLELFSE--KKGFDERAMIAQF------------------TSKSSKDLSTVQHGLEK 111
|:..|..:||.|..: |...|:...:||. |:||:.....| :..||
Fly 66 CYHSCVYKKLGLLGDDGKPNTDKIVKLAQIRFSSLPVDKLKSLLTSCGTTKSAATCDFV-YNYEK 129
Fly 112 CI 113
|:
Fly 130 CV 131
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
|
|
P |
PTHR11857 |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.