DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83g and Obp56b

DIOPT Version :8

Sequence 1:NP_731043.1 Gene:Obp83g / 170878 FlyBaseID:FBgn0046875 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_611443.1 Gene:Obp56b / 37265 FlyBaseID:FBgn0046880 Length:137 Species:Drosophila melanogaster

Alignment Length:67 Identity:16/68 (24%)
Similarity:25/68 (37%) Gaps:21/68 (31%)


  Fly    67 CFVKCFLEKLELFSE--KKGFDERAMIAQF------------------TSKSSKDLSTVQHGLEK 111
            |:..|..:||.|..:  |...|:...:||.                  |:||:.....| :..||
  Fly    66 CYHSCVYKKLGLLGDDGKPNTDKIVKLAQIRFSSLPVDKLKSLLTSCGTTKSAATCDFV-YNYEK 129

  Fly   112 CI 113
            |:
  Fly   130 CV 131

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp83gNP_731043.1 PBP_GOBP 22..134 CDD:279703 16/68 (24%)
Obp56bNP_611443.1 PhBP 35..135 CDD:214783 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.