DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83g and Obp8a

DIOPT Version :10

Sequence 1:NP_731043.1 Gene:Obp83g / 170878 FlyBaseID:FBgn0046875 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster


Alignment Length:116 Identity:23/116 - (19%)
Similarity:46/116 - (39%) Gaps:12/116 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KAFEECREDYYVPDDIYEKYLNYEFPAHRRTSCFVKCFLEKLELFSEKKGFDERAMIAQFTSKSS 99
            :|.::|..:......:....:.:|..||.|.  ::.||..:|:|:.::.||..:.::..|..:..
  Fly    42 RARDQCGRELTAAQRLQLDRMQFEDAAHVRH--YLHCFWSRLQLWLDETGFQAQRIVQSFGGERR 104

  Fly   100 KDLSTVQHGLEKC----IDHNEAESDVCTWANRVFSCWL--PI----NRHV 140
            .::......:..|    .........|..|..|.|.|.|  |:    .||:
  Fly   105 LNVEQALPAINGCNAKTSSRGSGAQTVVDWCFRAFVCVLATPVGEWYKRHM 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83gNP_731043.1 PBP_GOBP 25..134 CDD:460193 19/102 (19%)
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 19/102 (19%)

Return to query results.
Submit another query.