DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83g and LOC1280375

DIOPT Version :10

Sequence 1:NP_731043.1 Gene:Obp83g / 170878 FlyBaseID:FBgn0046875 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_320222.3 Gene:LOC1280375 / 1280375 VectorBaseID:AGAMI1_006654 Length:134 Species:Anopheles gambiae


Alignment Length:134 Identity:36/134 - (26%)
Similarity:48/134 - (35%) Gaps:27/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ATFLVAQTTAKFLLKDHADAEKAFE----ECREDYYVPDDIYEKYLNYEFPAHRR---------- 64
            ||.|:|...|...|.|  |..|..|    .|.|.:        |.||.|.....|          
Mosquito     6 ATVLLAVCAAAQPLTD--DQMKKAEGFALGCLEQH--------KGLNKEHLVLLRDGDFSKVDAD 60

  Fly    65 TSCFVKCFLEKLELFSEKKGFDERAMIAQFTSKSSKDLSTVQHGLEKCIDHNEAESDVCTWANRV 129
            |.||::|||::...............|.:.:....|  |.|:..::||....|.| |.|..|.|.
Mosquito    61 TKCFLRCFLQQANFMDAAGKLQNDYAIERLSLNREK--SKVEALVKKCSAGVEVE-DSCETAFRA 122

  Fly   130 FSCW 133
            ..|:
Mosquito   123 VECY 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83gNP_731043.1 PBP_GOBP 25..134 CDD:460193 31/123 (25%)
LOC1280375XP_320222.3 None

Return to query results.
Submit another query.