DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lrp5 and arr

Sequence 1:NP_032539.2 Gene:Lrp5 MGIID:1278315 Length:1614 Species:Mus musculus
Sequence 2:NP_524737.2 Gene:arr FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster

Alignment Length:1662 Identity:709/1663 (43%)
Similarity:993/1663 (60%) Gaps:139/1663 (8%)


Mouse    27 PAAA---SP-LLLFANRRDVRLVD----AGGVKLESTIVASGLEDAAAVDFQFSKGAVYWTDVSE 83
            ||:|   :| .|||..|.|:::.:    .||.:::  ::...|.:|.|:||.::|..|.|||...
  Fly    78 PASAFVNTPATLLFTTRHDIQVANITRPTGGPQID--VIVRDLAEAMAIDFYYAKNLVCWTDSGR 140

Mouse    84 EAIKQTYLNQTG------AAAQNIVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRK 142
            |.|:....|.:.      |..|.::.:||..|:|||.||...|:||||.|.||||||.|:|..:|
  Fly   141 EIIECAQTNSSALQPLLRAPKQTVISTGLDKPEGLAMDWYTDKIYWTDGEKNRIEVATLDGRYQK 205

Mouse   143 VLFWQDLDQPRAIALDPAHGYMYWTDWGEAPRIERAGMDGS--TRKIIVDSDIYWPNGLTIDLEE 205
            ||||.|||||||:|:.||...:.||||||.|:||||.|||.  :|..:|...::|||||.:||:.
  Fly   206 VLFWTDLDQPRAVAVVPARKLLIWTDWGEYPKIERASMDGDPLSRMTLVKEHVFWPNGLAVDLKN 270

Mouse   206 QKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKWTGEQR 270
            :.:||.|.|..||....||||.|:.:| .:|.:||:||...|.|||||||..|::|.:..|.| .
  Fly   271 ELIYWTDGKHHFIDVMRLDGSSRRTIV-NNLKYPFSLTFYDDRLYWTDWQRGSLNALDLQTRE-L 333

Mouse   271 KEILSALYSPMDIQVLSQERQPPFHTPCEEDNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKTC 335
            ||::....:|..::......||....||..:||.|||||||:.....:||||||||:| .:..||
  Fly   334 KELIDTPKAPNSVRAWDPSLQPYEDNPCAHNNGNCSHLCLLATNSQGFSCACPTGVKL-ISANTC 397

Mouse   336 KTGAEEVLLLARRTDLRRISLDTPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAY 400
            ..|::|::.:.:||.:.:||||:||:|...|.:|.:::||||||||:|.::||:|.|...|:||:
  Fly   398 ANGSQEMMFIVQRTQISKISLDSPDYTIFPLPLGKVKYAIAIDYDPVEEHIYWSDVETYTIKRAH 462

Mouse   401 LDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVL 465
            .||:|....|.:|:..|||:|:||:|||||||||.||||||.||:||:||:|:.|.|:|||||.:
  Fly   463 ADGTGVTDFVTSEVRHPDGLALDWLARNLYWTDTVTDRIEVCRLDGTARKVLIYEHLEEPRAIAV 527

Mouse   466 HPVMGLMYWTDWGE-NPKIECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVI 529
            .|.:|.|:|:||.| .||:|.|:|||.:|.|||:.:||||||:|||::...:||.|.|||||||.
  Fly   528 APSLGWMFWSDWNERKPKVERASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGKTDKIEVA 592

Mouse   530 NIDGTKRKTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKA-SRDVIIDQLPDLMGLKAV 593
            |:||:.|:.::.|.|.|:||.::|.|::||||||||||:|.||:.. :|.|::||.|||||||..
  Fly   593 NMDGSGRRVVISDNLKHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQYPDLMGLKVT 657

Mouse   594 NVAKVVGTNPCADGNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIIPEAFLVFTSRATIHRIS 658
            .:.:|.|.|.||..||||||||...||...|.|.|..||.:|.:||::|.|||:|:.:..|.|||
  Fly   658 RLREVRGQNACAVRNGGCSHLCLNRPRDYVCRCAIDYELANDKRTCVVPAAFLLFSRQEHIGRIS 722

Mouse   659 L---ETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPE 720
            :   |.|:||..||...|::|.|||..|:...|||||...|.|.|||:|||.|:.:::.||..|:
  Fly   723 IEYNEGNHNDERIPFKDVRDAHALDVSVAERRIYWTDQKSKCIFRAFLNGSYVQRIVDSGLIGPD 787

Mouse   721 GMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRI 785
            |:||||:..|:||:|....|||||||||..|:||:|:.::.||||.|:|.:||:|||| .....|
  Fly   788 GIAVDWLANNIYWSDAEARRIEVARLDGSSRRVLLWKGVEEPRSLVLEPRRGYMYWTE-SPTDSI 851

Mouse   786 VRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYW-TDLDTNMIESSNMLGQERMV-IADDLPYPF 848
            .||.|||::..|:|.....|..||.|...:|||| |......|||::..|::|.: :..|:..|:
  Fly   852 RRAAMDGSDLQTIVAGANHAAGLTFDQETRRLYWATQSRPAKIESADWDGKKRQILVGSDMDEPY 916

Mouse   849 GLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHSNGQCG 913
            .::.|.||:||:|||...|||..||:|:||:|:...:.::..:|||:..||.|:|.|..:||.|.
  Fly   917 AVSLYQDYVYWSDWNTGDIERVHKTTGQNRSLVHSGMTYITSLLVFNDKRQTGVNPCKVNNGGCS 981

Mouse   914 QLCLAIPG--GHRCGCASHYTLDPSSRNCSPPSTFLLFSQKFAISRMIPDDQLSPDLVLPLHGLR 976
            .||||.||  |..|.|.:||.|.....:|.||..:::|||:....|::|:....|::.||:.| :
  Fly   982 HLCLAQPGRRGMTCACPTHYQLAKDGVSCIPPRNYIIFSQRNCFGRLLPNTTDCPNIPLPVSG-K 1045

Mouse   977 NVKAINYDPLDKFIYWVDGR-QNIKRAKDDGTQPSMLTSPSQSLSPDRQPHDLSIDIYSRTLFWT 1040
            |::|::|||:...|||::|| .:|||:..:||:.|:|.:..       ||.||:|||..|.||||
  Fly  1046 NIRAVDYDPITHHIYWIEGRSHSIKRSLANGTKVSLLANSG-------QPFDLAIDIIGRLLFWT 1103

Mouse  1041 CEATNTINVHRLDGDAMGVVLRGDRDKPRAIAVNAERGYMYFTNMQDHAAKIERASLDGTEREVL 1105
            |..:|:|||....|:::||:..||.:|||.|||:|.:..:::|::..|.| |.||.:||.|| |.
  Fly  1104 CSQSNSINVTSFLGESVGVIDTGDSEKPRNIAVHAMKRLLFWTDVGSHQA-IIRARVDGNER-VE 1166

Mouse  1106 FTTGLIRPVALVVDNALGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGRHLYWID 1170
            ....|....||.:|.....:::  |..|||::.|::|.|:.||...:|.|.:.:..||..:||:|
  Fly  1167 LAYKLEGVTALALDQQSDMIYY--AHGKRIDAIDINGKNKKTLVSMHISQVINIAALGGFVYWLD 1229

Mouse  1171 RQQQMIERVEKTTGDKRTRVQGRVTHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTP 1235
             .:..:||: ...|::|:....|:..:|.|.||.....:....|.|......|||||||.|:|..
  Fly  1230 -DKTGVERI-TVNGERRSAELQRLPQITDIRAVWTPDPKVLRNHTCMHSRTKCSHICIASGEGIA 1292

Mouse  1236 R----CSCPVHLVLLQNLLTCGEPPTCSPDQFACTT-----GEI--DCIPGAWRCDGFPECADQS 1289
            |    ||||.||:||::...||..|.|.||.|.|..     .::  ||||.:|||||..:|.|:|
  Fly  1293 RTRDVCSCPKHLMLLEDKENCGAFPACGPDHFTCAAPVSGISDVNKDCIPASWRCDGQKDCPDKS 1357

Mouse  1290 DEEGCPVCSASQFPCARGQCVDLRLRCDGEADCQDRSDEANCDAVC-LPNQFRCTSGQ-CVLIKQ 1352
            ||.|||.|.|.||.|..|:|:|..|.|||..:|.:..|||:|   | .|.:|:|...: |:....
  Fly  1358 DEVGCPTCRADQFSCQSGECIDKSLVCDGTTNCANGHDEADC---CKRPGEFQCPINKLCISAAL 1419

Mouse  1353 QCDSFPDCADGSDE---LMCEINKPPSDDIPAHSSAIGPVIGIILSLFVMGGVYFVCQRVMCQRY 1414
            .||.:.:||||:||   :..:....|:.|..|....||..:..|.|:     ||.:   ..|:..
  Fly  1420 LCDGWENCADGADESSDICLQRRMAPATDKRAFMILIGATMITIFSI-----VYLL---QFCRTR 1476

Mouse  1415 TGASGPFPHEYVGGAPHVPLNFIAPGGSQHGPFPGIPCSKSVMSS----------MSLVGGRGSV 1469
            .|.|...|.:.....|..|...                |||...|          ||.:..|.|:
  Fly  1477 IGKSRTEPKDDQATDPLSPSTL----------------SKSQRVSKIASVADAVRMSTLNSRNSM 1525

Mouse  1470 PLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNVDVFYSSGIPATARPYRPYVIRG 1534
            ..|||||:||||||:::.:....||  :||||||||                .:.||||.|.|..
  Fly  1526 NSYDRNHITGASSSTTNGSSMVAYP--INPPPSPAT----------------RSRRPYRHYKIIN 1572

Mouse  1535 MAPPTTPCSTDVC---DSDYST------SRWKSSKY-------YLDLNSDSDPYPPPPTPHSQYL 1583
            ..||.||||||:|   ||:|::      |...::|:       .|....||:||||||||.|.|.
  Fly  1573 QPPPPTPCSTDICDESDSNYTSKSNSNNSNGGATKHSSSSAAACLQYGYDSEPYPPPPTPRSHYH 1637

Mouse  1584 S-----AEDSCPPSPGTERS-YCHLFPPPPSPCTDSS 1614
            |     .|.||||||.:..| |....||||||....|
  Fly  1638 SDVRIVPESSCPPSPSSRSSTYFSPLPPPPSPVQSPS 1674

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lrp5NP_032539.2 Beta-propeller 1 31..287 115/269 (43%)
NHL <36..>168 CDD:302697 59/142 (42%)
NHL repeat 64..103 CDD:271320 14/45 (31%)
LY 101..141 CDD:214531 22/40 (55%)
NHL repeat 106..147 CDD:271320 26/41 (63%)
Ldl_recept_b 162..202 CDD:278487 21/42 (50%)
LY 186..228 CDD:214531 18/42 (43%)
LY 229..270 CDD:214531 18/41 (44%)
LDL-receptor class B 5 247..289 15/42 (36%)
FXa_inhibition 298..335 CDD:291342 20/37 (54%)
Beta-propeller 2 340..601 142/263 (54%)
LY 365..405 CDD:214531 20/40 (50%)
LY 407..449 CDD:214531 27/42 (64%)
LY 450..493 CDD:214531 23/44 (52%)
LY 494..536 CDD:214531 25/42 (60%)
LY 537..570 CDD:214531 18/33 (55%)
FXa_inhibition 604..639 CDD:291342 19/35 (54%)
Beta-propeller 3 643..902 118/264 (45%)
NHL 684..877 CDD:302697 89/195 (46%)
LY 709..751 CDD:214531 21/42 (50%)
NHL repeat 719..755 CDD:271320 22/36 (61%)
NHL repeat 762..801 CDD:271320 20/39 (51%)
NHL repeat 807..842 CDD:271320 13/37 (35%)
NHL repeat 846..870 CDD:271320 12/24 (50%)
FXa_inhibition 905..940 CDD:291342 16/37 (43%)
Beta-propeller 4 944..1211 95/268 (35%)
LY 969..1008 CDD:214531 18/40 (45%)
LY 1059..1102 CDD:214531 19/43 (44%)
LY 1103..1145 CDD:214531 12/42 (29%)
FXa_inhibition 1216..1252 CDD:291342 19/40 (48%)
LDLa 1258..1294 CDD:238060 20/43 (47%)
LDLa 1297..1331 CDD:238060 16/34 (47%)
LDLa 1335..1369 CDD:238060 13/39 (33%)
PPPSP motif A 1499..1505 6/6 (100%)
PPPSP motif B 1537..1544 6/7 (86%)
PPPSP motif C 1573..1580 6/7 (86%)
PPPSP motif D 1590..1595 4/5 (80%)
PPPSP motif E 1604..1611 6/7 (86%)
arrNP_524737.2 LY 162..201 CDD:214531 22/39 (56%)
NHL 168..503 CDD:302697 170/338 (50%)
NHL repeat 172..237 CDD:271320 42/65 (65%)
LY 252..293 CDD:214531 18/41 (44%)
NHL repeat 261..298 CDD:271320 18/38 (47%)
NHL repeat 303..339 CDD:271320 18/37 (49%)
NHL repeat 341..419 CDD:271320 32/79 (41%)
NHL repeat 428..476 CDD:271320 23/48 (48%)
LY 472..511 CDD:214531 27/39 (69%)
NHL repeat 477..503 CDD:271320 20/26 (77%)
Ldl_recept_b 534..573 CDD:278487 24/39 (62%)
LY 558..599 CDD:214531 25/41 (61%)
LY 600..641 CDD:214531 20/41 (49%)
FXa_inhibition 668..703 CDD:291342 19/35 (54%)
LY 739..773 CDD:214531 18/34 (53%)
LY 776..818 CDD:214531 21/42 (50%)
LY 819..860 CDD:214531 21/42 (50%)
FXa_inhibition 973..1010 CDD:291342 16/37 (43%)
LY 1122..1164 CDD:214531 19/43 (44%)
FXa_inhibition 1273..1313 CDD:291342 19/40 (48%)
LDLa 1319..1362 CDD:238060 20/43 (47%)
LDLa 1365..1399 CDD:238060 16/34 (47%)
LDLa 1399..1433 CDD:197566 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1329 1.000 Inparanoid score I143
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D121310at2759
OrthoFinder 1 1.000 FOG0002706
OrthoInspector 1 1.000 T615270
orthoMCL 1 0.900 OOG5_126933
Panther 1 1.100 LDO PTHR46513
Phylome 1 0.910 0.963 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4876
TreeFam 1 0.960
1211.870

Return to query results.
Submit another query.