DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lifr and sdk

Sequence 1:NP_001345522.1 Gene:Lifr MGIID:96788 Length:1092 Species:Mus musculus
Sequence 2:NP_001284756.1 Gene:sdk FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster

Alignment Length:1361 Identity:274/1362 (20%)
Similarity:453/1362 (33%) Gaps:476/1362 (35%)


Mouse    24 NLPWLLSALTLLHLTMHANGLKRGVQ-DLKCTTNNMRVWDCTWPAPLGVSPG---------TVKD 78
            |:.|.....:   .|..:|..:.||| |.:.....:|..|....|.:..|||         :|.:
  Fly   623 NIDWYREGQS---STPISNSQRIGVQADGQLEIQAVRASDVGSYACVVTSPGGNETRAARLSVIE 684

Mouse    79 ICIKDRFHSCHPLETTNVKIPAL-SPGDHEVTINYLNGFQ-----SKFTLNEKDVSLIPETP--- 134
            :          |...:|||:..| .|....:.:::..||.     |||.:..::||.:...|   
  Fly   685 L----------PFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELGPVPDPL 739

Mouse   135 -----EILDLSAD----------------FFTSSLLLKWNDRGSALP-HPSNATWEIKVLQN-PR 176
                 |:.::|||                |..|::    |..|...| .|||.   :::.|. |.
  Fly   740 LNWITELSNVSADQRWILLENLKAATVYQFRVSAV----NRVGEGSPSEPSNV---VELPQEAPS 797

Mouse   177 TEPVALVLLNTMLSGKDTVQHWNWTSDLPLQCATHSVSIRWHIDSPHFSGYKE--WSDWSPLKN- 238
            ..||..|  .:..|..:.:..|    ..||: ...:..|..:|......||..  || :..:.| 
  Fly   798 GPPVGFV--GSARSMSEIITQW----QPPLE-EHRNGQILGYILRYRLFGYNNVPWS-YQNITNE 854

Mouse   239 ----------ISW-----------------------IRNTE-------TNVFPQDKVVLAGSNMT 263
                      |:|                       |:..|       |||    ||....|...
  Fly   855 AQRNFLIQELITWKDYIVQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPTNV----KVEAINSTAA 915

Mouse   264 ICCMSP-------------------TKVLSGQIGNTLRPLIHLYGQTVAIHILNIPVSENS---- 305
            .|..:|                   .:::.|:..:..|.:     :||...::: |::|.:    
  Fly   916 RCRWTPPNPQQINGINQGYKIQAWQRRLIDGEWRDIERRM-----KTVPPSLID-PLAEQTAILG 974

Mouse   306 --------GTNIIFITD--DDVYGTVVFAGYPPDVPQKLS-CETHDL--KEIICSWNPGRIT-GL 356
                    ..:::..||  |.|..:.|......|||.::: ....|:  :.:...|.|.|.: |:
  Fly   975 GLEKFTEYNISVLCFTDPGDGVASSQVAVMTMDDVPDEVTGLHFDDVSDRSVKVLWAPPRASNGI 1039

Mouse   357 VGPRNTEYTLFESISGKSAVFHRIEGLTNET----YRLGVQMHPGQEIHNFTLTGRNPLGQAQSA 417
            :    |.||:...:..:...........::|    .:|....|...||..:|..|.   |..::|
  Fly  1040 L----TGYTVRYQVKDRPDTLKSFNLTADDTELTVNQLQATTHYWFEIVAWTRVGS---GIPKTA 1097

Mouse   418 VVINVTERVAPHDPTSLKVKDIN--STVVTFS-----------WYLPGNFTKINL----LCQI-- 463
            .:.:..|.|.||.||:|.:.:|.  |.|:.|:           |.:.|. |..|:    :|:|  
  Fly  1098 TIQSGVEPVLPHAPTALALSNIEAFSVVLQFTPGFDGNSSITKWKVEGQ-TARNMTWFTICEIND 1161

Mouse   464 ---------------------------------------EICKANSKKEVRNATIRG-------- 481
                                                   :..:|..|....|.|:|.        
  Fly  1162 PDAETLTVTGLVPFTQYRLRLSASNVVGSSKPSEATKDFQTIQARPKHPPFNVTVRAMSAQQLRV 1226

Mouse   482 ---------------------------------------AEDST--YHVAVDKLNPYTAYTFR-- 503
                                                   .||.|  .|| :|.|..:|.|..:  
  Fly  1227 RWIPLQQTEWYGNPRGYNISYKQLVKTPGTIKYVPRSVVIEDHTANSHV-LDSLEEWTLYEVKMN 1290

Mouse   504 ----VRCSSKTFWKWSRWSDEKRHLTTEATPSKGPDTWREWSSDGKNLIVYWKPLPINEANGKIL 564
                |.||.:        ||.....|.||.||.||...:..::....::|.|..:|....||:|.
  Fly  1291 ACNDVGCSKE--------SDTAVERTREAVPSYGPLDVQANATSSTTVVVQWGEVPRQHRNGQID 1347

Mouse   565 SYNVSCSLNEETQSVLEIFDPQH----RAEIQLSKN-DYIISVVA----RNSAGSSPPSKIASME 620
            .|.|..:..:..|.||....|.:    ....:|.|. .|.:.|:|    .|.|.|:||.::.:.|
  Fly  1348 GYKVFYAAADRGQQVLHKTIPNNATFTTTLTELKKYVVYHVQVLAYTRLGNGALSTPPIRVQTFE 1412

Mouse   621 ----IPND----DITVEQAVGLGNRIFLTWRHDPN-----MTCDYVIK---WCNSSRSEPCLLDW 669
                :|::    |:::..|     ||......|||     ....|.:.   ..|.||..|     
  Fly  1413 DTPGVPSNVSFPDVSLTMA-----RIIWDVPVDPNGKILAYQVTYTLNGSAMLNYSREFP----- 1467

Mouse   670 RKVPSNSTETVIESDQFQPGVRYNFYLYGCTNQ---GYQLLRSIIGYV-----EELAPIVAPNFT 726
               ||:.|   ..:.:..||   .:|.:.||.|   |:..:.:.:.|.     ...||.| |..:
  Fly  1468 ---PSDRT---FRATELLPG---KYYSFSCTAQTRLGWGKIATALVYTTNNRERPQAPSV-PQIS 1522

Mouse   727 VEDTSADSILVKWDDIPVEELRGF--LRGYLFYFQKGE-RDTPKTRSLEPHHSDIKLKNITDISQ 788
            .....|..|...|  .|..:  ||  ||.|....::.| |..|.     |...|..|.:.|.:. 
  Fly  1523 RSQIQAHQITFSW--TPGRD--GFAPLRYYTVEMRENEGRWQPL-----PERVDPSLSSFTAVG- 1577

Mouse   789 KTLRIADLQGKTSYHLVLRAYTHGGLGPEKSMFVVTKENSVGLIIAILIPVAVAVIVG------- 846
                   |:...:|...::|  ...|||  |.|  ::|:    :|...:|.|.||.||       
  Fly  1578 -------LRPYMTYQFRIQA--TNDLGP--SAF--SRES----VIVRTLPAAPAVGVGGLKVVPI 1625

Mouse   847 VVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSNALKTLEMNPCTPNNVEVLESRSI 911
            ..||:    :.:|                            :||:|...|    .:......|.:
  Fly  1626 TTTSV----RVQW----------------------------SALETALWN----GDASTGGYRIL 1654

Mouse   912 VPKIEDTEIISPVAERPGERSEVD--PENHVVVSYCPPIIEEEI-------------TNPAADEV 961
            ..::.|    .|.|.:...:::|.  .||.||:|........||             |.|||..|
  Fly  1655 YQQLSD----FPTALQSTPKTDVHGINENSVVLSDLQQDRNYEIVVLPFNSQGPGPATPPAAVYV 1715

Mouse   962 G-----------GASQVVYIDVQSMYQPQAKAEEEQDVDPVVVAGYKPQMRLPISP-AVEDTAAE 1014
            |           .|:.:...:|:.:::|..::.:..|     :.|||....:..|| |:|.....
  Fly  1716 GEAVPTGEPRAVDAAPISSTEVRLLWKPPKQSMQNGD-----ILGYKIYYLVTYSPQALEPGRKW 1775

Mouse  1015 DEEGKTAGYRPQANVNTWNLVSPDSPRSTDSNNEVVSFGSPCSINSRQFLIPPKDEDSPKS 1075
            :||.:..    .|...:.:||..|  :.|:...::::| :|..             |.|:|
  Fly  1776 EEEIEVV----SATATSHSLVFLD--KFTEYRIQLLAF-NPAG-------------DGPRS 1816

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LifrNP_001345522.1 FN3 428..525 CDD:238020 34/210 (16%)
WSXWS motif 514..518 0/4 (0%)
FN3 547..614 CDD:328772 22/76 (29%)
FN3 724..816 CDD:238020 21/95 (22%)
Box 1 motif 864..872 0/8 (0%)
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845
IG_like 280..356 CDD:214653
Ig 280..343 CDD:299845
IG_like 375..450 CDD:214653
Ig 378..447 CDD:143165
Ig 506..587 CDD:299845
IG_like 506..587 CDD:214653
I-set 592..682 CDD:254352 14/62 (23%)
Ig 595..682 CDD:299845 14/62 (23%)
FN3 686..789 CDD:238020 26/110 (24%)
FN3 798..893 CDD:238020 17/103 (17%)
FN3 901..1005 CDD:238020 19/114 (17%)
fn3 1011..1094 CDD:278470 16/90 (18%)
FN3 1108..1202 CDD:238020 15/95 (16%)
FN3 1210..1308 CDD:238020 17/107 (16%)
fn3 1317..1402 CDD:278470 20/85 (24%)
FN3 1415..1507 CDD:238020 24/111 (22%)
FN3 1513..1608 CDD:238020 30/123 (24%)
fn3 1617..1708 CDD:278470 21/131 (16%)
FN3 1722..1823 CDD:238020 23/121 (19%)
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.