DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BHLHA15 and sage

DIOPT Version :10

Sequence 1:NP_803238.1 Gene:BHLHA15 / 168620 HGNCID:22265 Length:189 Species:Homo sapiens
Sequence 2:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster


Alignment Length:82 Identity:31/82 - (37%)
Similarity:43/82 - (52%) Gaps:9/82 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    70 RDSSIQR----RLESNERERQRMHKLNNAFQALREVIPHVRAD-KKLSKIETLTLAKNYIKSLTA 129
            |:.::|.    |..:.:|||.||..:|.||..||..:|..:.: ||.||||:|.:|.|||..|.|
  Fly   170 REKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQA 234

Human   130 TILTMSSSRLPGLEGPG 146
            .:...|    .|..|.|
  Fly   235 MLRESS----VGQNGNG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BHLHA15NP_803238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..85 4/18 (22%)
bHLH_TS_MIST1 76..137 CDD:381554 26/65 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..189
sageNP_524287.1 bHLH_TS 181..236 CDD:381396 25/54 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.