DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BHLHA15 and Fer1

DIOPT Version :10

Sequence 1:NP_803238.1 Gene:BHLHA15 / 168620 HGNCID:22265 Length:189 Species:Homo sapiens
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:82 Identity:32/82 - (39%)
Similarity:50/82 - (60%) Gaps:5/82 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    75 QRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRL 139
            |:|..:|.|||:||..:|.||:.||..||.:..:|:|||::||.||.:||..|:..:....:...
  Fly    86 QQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNE 150

Human   140 PGLEGPGPKLYQHYQQQ 156
            |||     .|.::||::
  Fly   151 PGL-----SLQRNYQKE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BHLHA15NP_803238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..85 4/9 (44%)
bHLH_TS_MIST1 76..137 CDD:381554 25/60 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..189
Fer1NP_001262334.1 bHLH_TS_PTF1A 87..142 CDD:381423 25/54 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.