DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lama3 and wb

Sequence 1:XP_006525748.1 Gene:Lama3 MGIID:99909 Length:3331 Species:Mus musculus
Sequence 2:NP_723870.1 Gene:wb FlyBaseID:FBgn0261563 Length:3375 Species:Drosophila melanogaster

Alignment Length:3799 Identity:906/3800 (24%)
Similarity:1401/3800 (37%) Gaps:1091/3800 (29%)


Mouse    41 SRSLHPPYFNLAQAARIWATATCGERDPEVSRPRPELFCKLVGGPAAQGSGHTIQGQFCDYCNSE 105
            |..|:||.||:...|:|...||||:...|.       :||.||...            |..||:.
  Fly   150 SGGLYPPLFNVVPRAQISVNATCGQNGAEE-------YCKQVGAKP------------CGICNAH 195

Mouse   106 DSRKAHP-------ASHAIDGS-----ERWWQSPPLSSGTQYNQVNLTLDLGQLFHVAYILIKFA 158
            .|.:|..       :|.:..||     |.|||||.|..|.|:..|.:.|||.|.|.:..:.:|.|
  Fly   196 SSDRAKQRSIQSLISSGSGSGSGSGFEEGWWQSPTLQGGRQFEYVTILLDLKQTFQIFSVWLKSA 260

Mouse   159 NSPRPDLWILERSVDFGSTYSPWQYFAHSRRDCVEQF---GQEANMAITQDDQMLCVTEYSRIVP 220
            |||||..||||:|:| |..:.|||||..|..||..::   ||........|.:::|.|::|:..|
  Fly   261 NSPRPASWILEKSLD-GINFEPWQYFGLSDADCQRRWNLSGQNGKYVFQNDTEIICSTQFSKPGP 324

Mouse   221 LENGEIVVSLINGRPGAKKFAFSDTLREFTKATNIRLRFLRTNTLLGHLISKAERD--------- 276
            ||||.:..||:..||||..  .|..|.:|.....||:|       |..:.|.|.:|         
  Fly   325 LENGVLHASLLKNRPGATD--QSPELMKFITTRYIRIR-------LQGMHSTANQDNSLDWLLDS 380

Mouse   277 PTVTRRYYYSIKDISVGGRCVCNGHAEAC--SADNPEKQFRCECQHHTCGDTCNRCCAGYNQRRW 339
            |::.:..:||:..:.|..|..|||||...  |.|:|..|  |.|||:|||..|.:||..:..|.:
  Fly   381 PSLEKHSFYSLSQLKVSARLDCNGHANRSHESPDDPLMQ--CICQHNTCGAQCEQCCPLFQDRPY 443

Mouse   340 QPAGQEQHNECEACNCHGHAVDCYYDPDVEHQQASLNSKGVYAGGGVCINCQHNTAGVNCEKCAK 404
            |..|     |||.|.|:|||..|.|||              :...|:|.:|.:||||:.||.|..
  Fly   444 QMGG-----ECEICQCYGHAESCTYDP--------------FLDKGICQSCSNNTAGIECEFCEM 489

Mouse   405 GYFRPHGVPVDALHGCIPCSCDPERA-DDCDQGSGHCHCKPNFSGDYCETCADGYYNFPFCLRIP 468
            |::|....|:  ...|:||||:|.|: ..|....|.|:|...|.|..||.||.|||.        
  Fly   490 GFYRELDAPL--TDPCLPCSCNPARSTGGCQSDGGSCNCLEGFQGKNCEECAPGYYG-------- 544

Mouse   469 VFPNYTPSPEDPVAGNIKGCDCNLEGVLPEICDDRGRCLCRPGVEGPQCDSCRSGSYSFPICQAC 533
                                            ||                           |:.|
  Fly   545 --------------------------------DD---------------------------CKRC 550

Mouse   534 QCSTIGSYPVPCDPGNGQCDCLPGITGRQCDRCLSGAYDFPYCQGSGSVCHPAGTLDSSLGYCQC 598
            :|...||.               |.||                              |..|.|||
  Fly   551 ECDERGSL---------------GSTG------------------------------SCSGVCQC 570

Mouse   599 KQHVASPTCSVCKPLYWNLAKENPRGCSECQCHEAGTLSGIGECGQEDGDCSC-KAHVTGDACDT 662
            |.:|...|||.|.|.|::|:.||..||:.|.|      ||:.:        :| .|.:...|.:|
  Fly   571 KLNVEGSTCSECAPGYFDLSAENAEGCTSCWC------SGVSQ--------TCHSAKLQTLAFET 621

Mouse   663 CEDGFFS------------------------LEKSNYFGCQGCQCDIGGALTTMCSGPSGVCQCR 703
            ..|...:                        |::......|.....:|..||:..|....|... 
  Fly   622 LNDWKITDIQRVKPISIPVDAETNRLIFANELDEVEAIYWQASLGYLGNRLTSYGSRLQLVLSW- 685

Mouse   704 EHVEGKQCQRPENNYYFPDLHHMKYEVEDGTGPN----GRN---LRFGFDPL---------VFPE 752
            :.:.|.:..:|.                  ||||    |:|   :.||.:.|         ...|
  Fly   686 DVIRGDRSGKPT------------------TGPNVILVGKNGLKIAFGDESLDGLGINLNVTLTE 732

Mouse   753 FSWRGYAPMTSVQNEVRVRL---------SVRQSSLSLFRIVLRYISPGTEAISGRITLYSSQGD 808
            ..|. :.|.|.|..:.|:|.         ||.:|......:.|       :|:..|...::.||:
  Fly   733 VGWY-HVPPTVVDIKTRLRRTEGGDYHGESVTRSQFLSVLVSL-------DAVLIRAAFHTDQGE 789

Mouse   809 SDALQSRKITFPPSKEPAFVTVPGNGFAGPFSITPGTWIACIQVEGVLLDYLVLLPRDYYEAFTL 873
            :            |.|.|.:...|....|..|         .|||..|.                
  Fly   790 T------------SLERAVIYSGGVELGGKSS---------SQVEQCLC---------------- 817

Mouse   874 QVPVTEPCAHTGSPQDNCLLYQHLPLTAFSCTLACEARHF--------LLDGELRPLAMRQPTPT 930
                  |..:||                    |:||...|        ..|.::....:..|...
  Fly   818 ------PAGYTG--------------------LSCEGCAFGFKRIYENTSDHQILSKCIPCPCNG 856

Mouse   931 HPAMVDL-SGREVELQL-----RLRVPQVGHYVVLLEYATEVEQLFVVDVNLKSSGSALAGQVNI 989
            |....|| ||...:...     |....|:|:|                       |:.|.|..| 
  Fly   857 HSNSCDLQSGNCGDCMHNTFGDRCERCQLGYY-----------------------GNPLQGTPN- 897

Mouse   990 YSCK------------YSIPCRSVVIDSLSRTAVHELLADADIQLKAHMAHFLLYHICIIPAEEF 1042
             .||            :|..|:....:.:......||:..|:             :||....|.:
  Fly   898 -DCKRCACPLSEDSNNFSPSCQLKSYNYMDLNPQFELIEHAE-------------YICTQCPEGY 948

Mouse  1043 STEYLRPQVHC-IASYRQHANP--------------------SASCVSL---------------- 1070
            :.:      || :.......||                    :..|::.                
  Fly   949 TGD------HCQVCDDGYFGNPRQPGSSCQRCDCAGGPCNVTTGECITCRGNTEGWHCERCKLGY 1007

Mouse  1071 ------------AHETPPTASILDATSRGLFSALPHEPSSPAD-------GVTLKAPQSQVTLKG 1116
                        .|.....:.:.|:|. |.....|.......|       .|.|:.|.......|
  Fly  1008 WGDPAVGCDPCHCHTEGSESGLCDSTD-GQCLCKPRYAGQKCDECDVGYANVELRCPSCNCDPLG 1071

Mouse  1117 LI------PHLGRHVFVIHFYQAEHPGFPTEVIVNGGRQWSGSFLASFCPHLLGCRDQVISDGQV 1175
            .:      ||.|:    .|..:.                            ::|.:.....||..
  Fly  1072 SLVQDRCDPHTGQ----CHCKEG----------------------------VMGAKCHECQDGYF 1104

Mouse  1176 EFDISEAEVAVTVKIPDGKSLTLVRVLVVPAENYD-----YQILHKTTVDKSSEFISSC------ 1229
            ..:      ||..::.|         |....:|.|     :::: ..|.|.:||...:|      
  Fly  1105 GMN------AVAYRMDD---------LAALRQNSDSDDDEWELV-PDTEDPNSESTVACEECHCS 1153

Mouse  1230 GGDSFYIDPQAASGFCKNSAR--------------SLVAFYHNGAIPCECDPAGTAGHHCSPEGG 1280
            ...|...|....:|.|...|.              :|.|  ..|...|.|||.|:.||.|:|..|
  Fly  1154 SVGSLSSDCDKRTGQCACLANVTGRRCDKCRPGHWNLTA--GEGCRDCRCDPHGSRGHECNPWTG 1216

Mouse  1281 QCPCRPNVIGRQCSRCATGYYGF-----PYCKPCNCGRRLCEEVTGKCLCPPHTVRPQCEVCEMN 1340
            ||.|:..|.|:.|:.|..|::||     ..|..|....::|:...|:|:||..|....|..|...
  Fly  1217 QCDCKIGVGGQHCNECTEGFFGFSTEGCQRCSACRSEGQVCDPHNGRCICPKFTRGLGCGQCVPG 1281

Mouse  1341 SFNFHPVAGCDVCNCSRKGTIEAAVSECDRDSGQCRCKPRVTGQQCDKCAPGFYQFPECVPCSCN 1405
            ::.:....||..|.|...|:|.   .:|....|||:|:...:|::||.||.|::.:|||..|.|:
  Fly  1282 TWGWQARLGCRECECDHIGSIG---QQCSTGDGQCQCREGYSGRKCDTCAIGYFGYPECRRCGCD 1343

Mouse  1406 RDGT----EPSVCDPETGACMCKENVEGPQCQLCREGSFYLDPTNPKGCTKCFCFGVNTDCQSS- 1465
            .:|:    :.|:.....|.|.||..|.|.:|..|.:.:|.|...||:|||:|||||.:.:|:.| 
  Fly  1344 AEGSFTQADGSIACDSNGQCPCKSLVVGLKCDTCMQSTFGLSAQNPEGCTRCFCFGRSGECEQSD 1408

Mouse  1466 ----HKQRAKFVDMMGWRLE-----TADGVDVPVSFNPGSN--------SMVADLQELPPSV--- 1510
                |.:.|:..::...::.     ::|...:.|....||:        ..:.||..:|.|.   
  Fly  1409 LSWGHIRMAESRNLSVQQIRPHSVPSSDYEYIVVVQMEGSSFHREDAEIQRMNDLSLVPKSTGNV 1473

Mouse  1511 ---------HSASWVAPPSYLGDKVSSYGGYLTYHAKSFGL--PGDMVLLGKQPDVQLTGQHMSL 1564
                     |...:..||.:.||:.|||||:|.:...:.|.  |.:..:||:.|.|||.. |..|
  Fly  1474 SIGAYGQFYHPLYFQLPPQFYGDRTSSYGGFLYFTLITEGAHKPLERNILGQYPLVQLHA-HSKL 1537

Mouse  1565 I----HKEPSDPRPDRLHHGRVQVIEGNFRHEGSSAPVSREELMTVLSRLERLHIRGLHFTETQR 1625
            :    ..|..:...:..|  ||.:.|..:::..:|..|.|..||..|..:..:.||...|.:.|.
  Fly  1538 LLDFYEYEEFEYSLNVTH--RVPLHESFWKYHHTSQAVDRNTLMAALQNIRHIFIRAFAFADFQE 1600

Mouse  1626 LTLGEVGLEEASDTGSGPR--AHLVEMCACPPDYTGDSCQGCRPG---YYWDNKSLP-------- 1677
            :.|..|.::.|........  |..||.|.||..:.|.|||.  ||   |.|.|.::.        
  Fly  1601 VVLQNVHMDAAIYIKGSTNLIAKGVERCKCPKRFDGLSCQD--PGRSFYRWRNTTIVESVFIEDL 1663

Mouse  1678 VGRCVPCNCNGHSNRCQDGSGICINCQHNTAGEHCERCQAGHYG--NAIHGSCRVCPCPHTN-SF 1739
            :||..||:|||.|:.|...:|:|.||:.||.|:||.:|..|.||  |:.|| |:.||||.|| :|
  Fly  1664 IGRAAPCHCNGRSSDCDRETGVCQNCRGNTGGDHCHQCAEGFYGDPNSPHG-CQACPCPETNRNF 1727

Mouse  1740 ATGCAVDGGAVRCACKPGYTGTQCERCAPGYFGNPQKF-GGSCQPCNCNSNG-QLGPCDPLTGDC 1802
            |.||.|..|.|.|.|||||||..||||..||||:|.:: ..:||||||:.:| |...||..||.|
  Fly  1728 ARGCNVWDGEVSCVCKPGYTGRLCERCQAGYFGDPMRYPNTTCQPCNCHPDGIQTEGCDVETGRC 1792

Mouse  1803 VNQEPKDGSPAEECDD------------CDSCVMTLLNDLASMGEELRL---------VKSKLQG 1846
            ..:|...|...::|..            ||:|.:.||:.:..:|.:||.         :.:..:.
  Fly  1793 YCREGVTGLKCDKCQAERHHLVDNGCKICDNCTLLLLDYMELVGNKLRRGMHNMDLTGIPAPYRK 1857

Mouse  1847 LSVSTGALEQ----------------------IRHMETQAKDLRNQLLGFRSATSSHGSKMDDLE 1889
            ||....|.|:                      |..:|..|::|:.|   .|.|.::.|       
  Fly  1858 LSEYESAYEKWNGRHWDFSQTKRRLQDYDSADILKLEAHAENLKFQ---SRKAVATIG------- 1912

Mouse  1890 KELSHLNREF--ETLQEKAQVNSRKAQTLYNNIDQT--------------------------IQS 1926
                  .|||  ::::|.|.........|.:.|.||                          :|:
  Fly  1913 ------KREFAIKSMREDAVTQQHSVGLLRSEILQTLSDLHGYGKSAHYLSLPTALKQARFYLQA 1971

Mouse  1927 AKELDMKIKNIVQNVHILLKQMARPGGEGTDLPVGDWS-RELAEAQRMMRDL-----RSRDFKKH 1985
            .:|.|..::.|........|.....|.      ..|.| .|....:.:.|||     |..|.:..
  Fly  1972 IREHDQMVQGIRSTNDCAWKHFYAMGN------ASDASFDESGRLEMLWRDLNQTNHRVVDMRLQ 2030

Mouse  1986 LQEAEAEKMEAQLLLHRIRTWL----ESHQVENNGLLKNIRDSLNDYEDKLQDLRSILQEAAAQA 2046
            :...:..:.||:.:|..:|...    ||||.     |..:...::|:.|                
  Fly  2031 VDRVQEVENEAEDVLEHVRNLSIRVGESHQE-----LDELNQRISDHLD---------------- 2074

Mouse  2047 KQATGINHENEGVLG-AIQRQMKEMDSLKNDFTKYLATADSSLLQTNNLLQQMDKSQKEYESLAA 2110
               .|...:.||:|. .:|||                      :..|..|.|:|    .|..|..
  Fly  2075 ---PGYLEQGEGLLRLTVQRQ----------------------IMLNGHLNQLD----GYRILLN 2110

Mouse  2111 ALNGARQELSDRVRELSRSGGKAPLVVEAEKHAQSLQELAKQLEEIKRNTSGDELVRCAVDAATA 2175
            ...|.:.|....||:        ..:.:|||||..|  ||:..|..::........|.|:.|::|
  Fly  2111 TTLGVKTEQQREVRK--------HWLPKAEKHASHL--LARSNEYARKFQPTRNGARIAMLASSA 2165

Mouse  2176 YENILNAIRAAEDAASKATSASKSAFQTVIKEDLPKRAKTL-SSDSEELLNEAKMT---QKRLQQ 2236
            :.||..||..|..|:..|            ||.:.:..:|| .||...::..||.:   .|:|||
  Fly  2166 HSNITEAINDARLASILA------------KERVYEAQRTLYPSDGSSMIERAKHSLHRSKQLQQ 2218

Mouse  2237 EVSPALNSLQQTLKTVSVQKDLLDANLTVARDDLHGIQRGDIDSVVIGAKSMVREANGITSEVLD 2301
            |      :|:|..|:            .|.:|.||..::     .|.|.||.:.::...|:.:..
  Fly  2219 E------ALKQMHKS------------NVLKDKLHRQEQ-----QVEGIKSTIYDSGLRTNNISG 2260

Mouse  2302 GLNPIQTDLGR--IKDSYESARR------------EDFSKALVDANNSVKKLTRKLPDLFIKIE- 2351
            .|..:.....|  .|||.|.|.|            :|..|::.:..||...|.   ||..||:. 
  Fly  2261 QLQGLSDGSARRQAKDSLEMADRTGEQMRAELQKAKDMQKSIQNMRNSFSNLE---PDWEIKLGM 2322

Mouse  2352 -----SINQQLLPLGNIS-----------------------DNVDRIRELIQQARDAANKVAIPM 2388
                 |:.|..|.|.|:|                       ..:.::|:.|.:||.||..:.:.:
  Fly  2323 AQENISLTQTNLRLANVSLSYLEQQAEKEQQVFEVWNNSMAQQLQQLRDQIAKARHAAEAIDVSL 2387

Mouse  2389 RFNGKSGVEVRLP-----NDLEDLKGYTSLSLFLQRPDLRENGGTEDMFVMYLGNKDASKDYIGM 2448
            ...|...:...||     :....::...:||..|:...|           ::|.:.:..  :|.:
  Fly  2388 ESLGPKCIRSYLPASYGLSTSNKIRMSFALSNHLESSPL-----------IHLASSEGR--HITL 2439

Mouse  2449 AVVDGQLTCVYNLGDREAEVQIDQVLTESESQEAVMDRVKFQRIYQFAKLNYTKEATSTKPKAPG 2513
            .:...::..|:|||...|.|....|:...:.        |:...:...:.|.|....|...:...
  Fly  2440 ELYKRRVRLVWNLGGTTATVTHPMVVHTRDP--------KYDDAWYHVEANRTLNLGSLVVRRMN 2496

Mouse  2514 VYDMESASSNTLL---NLDPENAVFY--------VGGYPPGFELPRRLRFPPYKGC----IELDD 2563
            .|. |....|.::   :.|.|:..||        :||:     ..:.|:|.|....    :|:|:
  Fly  2497 NYG-ELTPPNPVIITGSTDTEHTRFYQSRSDRISLGGF-----ASKDLQFTPGLNVVVHQVEVDN 2555

Mouse  2564 LNENVLSLYNFKTTFNLNTTEVEPCRRRKEESDKNYFEGTGYARI------PTQPNAPFPNFMQT 2622
               ..|.|:||.|:.......:...:.....|...:|.|.|||::      ||:.|  ..:...|
  Fly  2556 ---KPLGLWNFVTSEGSCGGSMVGAKESSASSTARHFNGLGYAQLMKTRPRPTRKN--LFSVQMT 2615

Mouse  2623 IQTTVDRGLLFFAENQDN--FISLNIEDGNLMVKYKLNSEPPKEKGIRDTINNGRDHMILISIGK 2685
            .:|..:..|||.|.:..|  .:|:.:..|.:|.:.....|...|.......|.|:...|..:...
  Fly  2616 FRTLDENALLFLAVDDKNNRSVSVTLSRGRIMFRIDYGDESKLEINTTKKYNVGQWIKIEAAREF 2680

Mouse  2686 SQKRMLIN------------------MNKHSIIIEGEIFDFS--TYYLGGIPIAIRERFNISTPA 2730
            |.||...|                  :|.|.:.      |.|  .|||||:|.......:.:..|
  Fly  2681 SAKRSTENGMLRVNNDRPISGAPTLPVNIHLLP------DLSKTVYYLGGVPPGFTSGTSKAPGA 2739

Mouse  2731 ---FQGCMKNLK---KTSGVVRLNDTVGVTKKCSEDWKLVRTASFSRGGQMSFTNLDVPSLD--- 2786
               |.||||:::   :|...:..:...||...|.   .::..|.||..|.     |::||..   
  Fly  2740 DNPFLGCMKDVQVNGETYDPLESSSYYGVEPSCK---NMITKAGFSGNGY-----LELPSQSLRK 2796

Mouse  2787 RFQLSFGFQTFQPSGTLL------------NHQTRTSSLLVTLEDG--HIALSTRDSSSPIFKSP 2837
            |...:..|:|.||...||            :.:....:..::|.||  |:.:::..|...:..:.
  Fly  2797 RSNTALVFRTLQPDCLLLLAAYPPEILGDYDAKDIKGNFSISLVDGQLHVWVNSGRSFIKMSSNS 2861

Mouse  2838 GTYMDGLLHHVSVISDTSGLRLLIDDQV-----LRRNQRLASFSNAQQSLSMGGG---------- 2887
            ....||..|.|.:|.....|.|::||::     |..|..:.|.......|.:||.          
  Fly  2862 SQMNDGEFHVVHLIKTGRKLELMVDDELQEIRNLNGNPTVVSLPRDAGGLYIGGAPPHESYTPLA 2926

Mouse  2888 ----YFEGCISN-VFVQRMSQSPEVLDMASKSTKRDAFLGGCSLNKPPFLMLFKSPKGFNKARSF 2947
                ..||.|.: ||..|.....:.|..|:....|:..|.| ||                |...:
  Fly  2927 PTFVNLEGAIRDVVFNNRTINFNDALTFANVQIGRNGPLMG-SL----------------KGGLY 2974

Mouse  2948 NVNQLLQDAPQAARSIEAWQDGKSCLPPLNTKATHRALQFGDSPTSHLLFKLPQELLKPR-LQFS 3011
            :|  ||:..|...:|..|..:|  |....:......|.:|||...|:...|||:.....| ...|
  Fly  2975 DV--LLKTEPMIGKSFTASPEG--CKRIGSYSYEPNAFKFGDDIYSYSQLKLPERHFWQRNFHLS 3035

Mouse  3012 LDIQTTSSRGLVF-HTGTRDS---FVALYLSEGHVIFALGAGGKKLRLRSKERYHDGKWHSVVFG 3072
            .|.::....|::: ..|:::.   :|||.|.:|.::..: .|.::..|:...:.:||:||.|...
  Fly  3036 FDFRSFYPNGMLYLSPGSKEKPKHYVALVLKDGQLVLVV-RGRRREELQLTAKLNDGEWHRVTIS 3099

Mouse  3073 LSGRKVHLVVDGLRAQE--------------------GSLPGNSTISPREQVYLGLSPSRKSKSL 3117
            ...|||.:.|:..|..:                    |.|| .|.:.....:|:.|.|       
  Fly  3100 CHDRKVTMSVEIGRTDQKTSAQMKLPKKIGASQLLLVGGLP-QSPVKVSSDLYVRLEP------- 3156

Mouse  3118 PQHSFVGCLRNFQLDSKPLD--SPSARSGVSPCLGGSLEKGIYFSQGGGHVVLANSVSLEPALTL 3180
                |.||||...:::...|  .|...|.|..|. .::|:|.|| .|..:.:...:.::...|.|
  Fly  3157 ----FKGCLRRVSINNNTQDLARPGKHSNVGQCF-PTVERGSYF-PGDAYAIYKKNFNVGKYLDL 3215

Mouse  3181 TLSIRPRSLTGVLIHIASQSG-EHLSVYMEAGKVTTSMNSEAGGTV---TSITPKRSLCDGQWHS 3241
            ....|...|:|:|:.::..:| ..||:.:..|.:..|.:...|..:   :|:..|.:|||.:||:
  Fly  3216 ETEFRTSELSGILLSVSDPNGFPALSLELHNGNIIFSCDPGNGAPMRVESSLPTKYALCDNKWHN 3280

Mouse  3242 VTVSIKQHTLHLELD-------TDNSYTAGQLSFPPNSTRGSLHIGGVPDKLKMLTLPVWNSFFG 3299
            ::.......:.|.:|       ..|...||::     .||..|:|||:|:.....:|....:|.|
  Fly  3281 ISALYDGEQIVLRIDQLPAVISVGNQGNAGKV-----QTRSPLYIGGLPESAPSGSLISRENFKG 3340

Mouse  3300 CLKNIQVNHIPVPITEATDVQGSVSLNGC 3328
            |::::.:.:......|..|:: :|.|:.|
  Fly  3341 CIRHVSIRNERRDWIEMEDLR-NVLLSEC 3368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lama3XP_006525748.1 LamNT 40..294 CDD:214532 93/277 (34%)
EGF_Lam 295..343 CDD:238012 22/50 (44%)
EGF_Lam 352..420 CDD:238012 22/68 (32%)
EGF_Lam 422..462 CDD:238012 19/41 (46%)
Laminin_EGF 488..535 CDD:278482 4/47 (9%)
EGF_Lam 532..574 CDD:238012 7/42 (17%)
Laminin_EGF 628..678 CDD:278482 10/75 (13%)
EGF_Lam 681..724 CDD:238012 7/43 (16%)
Laminin_EGF 1263..1311 CDD:278482 22/53 (42%)
EGF_Lam 1308..1349 CDD:238012 9/41 (22%)
EGF_Lam 1353..1398 CDD:238012 16/45 (36%)
EGF_Lam 1401..1451 CDD:238012 18/54 (33%)
LamB 1509..1638 CDD:214597 40/147 (27%)
EGF_Lam 1683..1729 CDD:238012 24/48 (50%)
EGF_Lam 1731..1782 CDD:238012 31/53 (58%)
Laminin_I 1842..2101 CDD:283627 57/320 (18%)
ApoLp-III_like 2146..>2253 CDD:304399 31/111 (28%)
Laminin_II 2285..2413 CDD:283628 35/176 (20%)
LamG 2432..2567 CDD:214598 27/150 (18%)
LamG 2599..2739 CDD:238058 43/171 (25%)
LamG 2766..2898 CDD:238058 39/169 (23%)
LamG 2990..3132 CDD:238058 38/167 (23%)
LamG 3156..3307 CDD:238058 39/162 (24%)
wbNP_723870.1 Laminin_N 164..396 CDD:278484 86/261 (33%)
EGF_Lam 401..450 CDD:238012 24/56 (43%)
TNFRSF <407..507 CDD:304602 45/123 (37%)
EGF_Lam 505..552 CDD:238012 23/114 (20%)
Laminin_EGF 550..597 CDD:278482 24/92 (26%)
Laminin_B 660..798 CDD:278481 35/177 (20%)
EGF_Lam 851..900 CDD:238012 15/74 (20%)
Laminin_EGF <943..971 CDD:278482 5/34 (15%)
VSP 953..1414 CDD:146106 117/515 (23%)
Laminin_EGF 974..1018 CDD:278482 1/44 (2%)
EGF_Lam 1017..1065 CDD:238012 9/49 (18%)
Laminin_EGF 1065..>1105 CDD:278482 8/72 (11%)
EGF_Lam 1150..1197 CDD:238012 8/49 (16%)
Laminin_EGF 1199..1247 CDD:278482 20/48 (42%)
EGF_Lam 1247..1292 CDD:238012 12/45 (27%)
Laminin_EGF 1294..1342 CDD:278482 19/51 (37%)
Laminin_EGF 1340..1392 CDD:278482 17/52 (33%)
Laminin_B 1486..1611 CDD:278481 37/128 (29%)
EGF_Lam 1669..1716 CDD:238012 24/48 (50%)
Laminin_EGF 1718..1767 CDD:278482 30/49 (61%)
EGF_Lam 1772..1819 CDD:238012 14/47 (30%)
CrfC <1933..2267 CDD:223771 92/435 (21%)
Laminin_II 2277..2400 CDD:283628 27/126 (21%)
LamG 2399..>2492 CDD:304605 19/114 (17%)
Laminin_G_2 2616..2755 CDD:280389 34/145 (23%)
Laminin_G_2 2804..2944 CDD:280389 31/140 (22%)
Laminin_G_2 3038..3169 CDD:280389 31/144 (22%)
LamG 3192..3347 CDD:238058 39/161 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1836
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000046
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.860

Return to query results.
Submit another query.