DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DES and LamC

Sequence 1:NP_001918.3 Gene:DES HGNCID:2770 Length:470 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster

Alignment Length:419 Identity:128/420 (30%)
Similarity:216/420 (51%) Gaps:69/420 (16%)


Human    48 SVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVEL 112
            ::.:||.:.| ||...||..:  :||:|.| :|:|                 ...|:|..||.||
  Fly     7 TLNTRVSRAS-TSTPVGGAST--SSRVGAT-SPTS-----------------PTRTSRQQEKEEL 50

Human   113 QELNDRFANYIEKVRFLEQQNAALAAEVNRLK---GREPTRVAELYEEELRELRRQVEVLTNQRA 174
            |.||||.|.||:::|.||.:|:.|..|:|..:   .||.:.:..:||:||...|:.::....::|
  Fly    51 QHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKA 115

Human   175 RVDVERDNLLDDLQRLKAKLQEEIQLKEEAENN-------------------------------- 207
            :::::...|.::...||.:|.::.:....||||                                
  Fly   116 KLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKEL 180

Human   208 ----------LAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVE 262
                      |...|..::|.||||:|||.:.:||.||:||..:||.:|:.|.:::.|.:..:::
  Fly   181 ALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEID 245

Human   263 MDMSK---PDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEY 324
            ..:|:   ..|..:|:::|.|||.....|..|.|..|.:::.:|..|||:.......|.:|:...
  Fly   246 GRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLM 310

Human   325 RHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQ 389
            |.:|.....::..|:.||..|..::||||:...:|...:...||.||.|::.::||||..|:|||
  Fly   311 RTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQ 375

Human   390 DLLNVKMALDVEIATYRKLLEGEESRINL 418
            .|:::|::||:|||.|.|||.|||.|:|:
  Fly   376 GLMDIKVSLDLEIAAYDKLLCGEERRLNI 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DESNP_001918.3 head 1..107 15/59 (25%)
Filament_head 9..106 CDD:309741 15/58 (26%)
Filament 107..415 CDD:306535 111/356 (31%)
rod 108..411 108/351 (31%)
tail 412..469 4/8 (50%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 111/356 (31%)
ATP-synt_B <67..>142 CDD:304375 18/75 (24%)
MreC <178..>224 CDD:302802 16/46 (35%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.