DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Serpina3c and Spn88Eb

Sequence 1:XP_011242304.1 Gene:Serpina3c MGIID:102848 Length:436 Species:Mus musculus
Sequence 2:NP_650427.1 Gene:Spn88Eb FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster

Alignment Length:431 Identity:104/432 (24%)
Similarity:181/432 (42%) Gaps:83/432 (19%)


Mouse    61 LDSLTLASIN---------TDFAFSLYKKLALKNPDTNIVFSPLSISAALAIVSLGAKGNTLEEI 116
            ||...|:.:|         .||:.:|.|::....|..|:.|||.|...||.:....:...|..|:
  Fly    20 LDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTEREL 84

Mouse   117 LEGLN----------------------FNLTETPEADIHQGFGHLLQRLSHPGEQVQISTGSALF 159
            .:.||                      |...::|                     :::|:.:.:|
  Fly    85 AQALNLGWALNKQQVLVSYTLAQRQDEFRWRQSP---------------------MELSSANRIF 128

Mouse   160 VEKHLQILAEFQEKARALYQAEAFTADFQ-QPLEATKLINDYVSNQTQRKIKGLIS--DLDTDTL 221
            |::.:.:..:|.   ..||.|.. ..||: .|....|.|||:::::|..:|:.::|  ::...|:
  Fly   129 VDRTINVSNKFN---TLLYGATK-ELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTM 189

Mouse   222 MVLVNYIYFKGKWKMPFNPRDTFESEFYLDVKRSVKVPMMKIKTLTTPYFRDEELSCTVVELKY- 285
            :||.|..|.||:|...|...:|....|:::.:....|.||. ||.......||.|...:::|.| 
  Fly   190 LVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMH-KTGAFKMTIDEGLQSQIIKLPYR 253

Mouse   286 ---------------KGNASALFILPDQGR--MQQVEASLQPETLRKWKNSLRPRKMGELYLPKF 333
                           |.:.|.:.|||:..:  :.:|.:.|..::::||.....|:|: ||.||||
  Fly   254 TIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKF 317

Mouse   334 SISTDYSLKNILPELGIKEIFSKQADLSGITGTK-DLIVSQMVHKAVLDVAETGTEGVAATGVNF 397
            .......|..||..:|:..:|::.|....:|... .|::....|.|.:.|.|.|:...|||.:..
  Fly   318 QFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLV 382

Mouse   398 RILSRR---TSLWFNRTFLMVISHTDVQTTLFIAKITHPKR 435
            ...||:   |....|..|:.:|....|.|.||....:.|::
  Fly   383 SRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDPRQ 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Serpina3cXP_011242304.1 alpha-1-antitrypsin_like 70..430 CDD:239011 100/416 (24%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 99/408 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.