DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Kdr and drpr

Sequence 1:NP_034742.2 Gene:Kdr MGIID:96683 Length:1345 Species:Mus musculus
Sequence 2:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster

Alignment Length:218 Identity:47/219 (21%)
Similarity:67/219 (31%) Gaps:88/219 (40%)


Mouse   590 SVHMGESLTPVCKNLDALWKLNGTMFSNSTNDILIVAFQNASLQDQGDYVCSA------------ 642
            |.:.||:...||:.|           :||:.|           .|.|:.:|||            
  Fly   569 SGYYGENCDKVCRCL-----------NNSSCD-----------PDSGNCICSAGWTGADCAEPCP 611

Mouse   643 ---QDKKTKKRHCLVKQLIILERMAPMITGNLENQTTTIGETIEVTCPAS--------------G 690
               ...:.|:| |  .:::...:....|||.:..:|..||.|.|..|||.              |
  Fly   612 PGFYGMECKER-C--PEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAGLYGPGCKLKCNCEHG 673

Mouse   691 NPTPHIT--------WFKD--NETLVEDS---GIVLRDGNRNLTIRRVRKEDG------------ 730
            ....|:|        |...  ||:...|:   |...|  .|.:..:..||.||            
  Fly   674 GECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQR--CRCVHHKVCRKADGMCICETGWSGTR 736

Mouse   731 -------GLYTCQACNVLGCARA 746
                   |.|.....|...|..|
  Fly   737 CDEVCPEGFYGEHCMNTCACPSA 759

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KdrNP_034742.2 IG_like 233..326 CDD:214653
Ig 241..327 CDD:299845
IG_like 342..419 CDD:214653
Ig 350..419 CDD:299845
Ig_2 545..650 CDD:290606 15/75 (20%)
IG 563..649 CDD:214652 15/74 (20%)
IG_like 672..748 CDD:214653 27/122 (22%)
IGc2 678..742 CDD:197706 24/110 (22%)
PTKc_VEGFR2 824..1165 CDD:270681
Pkinase_Tyr 832..1158 CDD:285015
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925 14/59 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.