DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Kcnq2 and KCNQ

Sequence 1:XP_017171224.1 Gene:Kcnq2 MGIID:1309503 Length:937 Species:Mus musculus
Sequence 2:NP_788300.3 Gene:KCNQ FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster

Alignment Length:1043 Identity:341/1044 (33%)
Similarity:464/1044 (44%) Gaps:299/1044 (29%)


Mouse    29 PGAPDSTRDGALLIAGSEAPKRGSVLSKPRTGGAGAGKPPKRNAFYRKLQNFLYNVLERPRG-WA 92
            ||.|:|.|   :|      ..|.|:|.||.....|.    :|:..||:||:.|||.|||||| .|
  Fly    22 PGRPNSER---IL------QPRMSLLGKPLNYNRGT----RRDVRYRRLQSRLYNFLERPRGLHA 73

Mouse    93 FIYHAYVFLLVFSCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGW 157
            ..||..|||:||:||.|||||||||||:.:...|:.:||:.::.|.:|:..|:|::||..||:|.
  Fly    74 IFYHVMVFLMVFTCLALSVFSTIKEYEEDAVYILFRMEILVVIWFTMEFGARLWSSGCRSRYQGC 138

Mouse   158 RGRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLG 222
            .|||||.::|||:|||:.::|||.||..|:.|.||||||||.|||.|||||:|||||||||||||
  Fly   139 LGRLKFVKRPFCIIDIVTILASIVVLGMGTSGQVFATSALRGLRFFQILRMVRMDRRGGTWKLLG 203

Mouse   223 SVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQT 287
            ||||||.:||:|..|||||.||.||||||:.||..||.|..:|.|||||:|||.|:||||..|.|
  Fly   204 SVVYAHRQELITTMYIGFLGLIFASFLVYMWEKDVNDKFSNFAQALWWGVITLCTVGYGDMVPIT 268

Mouse   288 WNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLIQSAWRFYAT--- 349
            |.|:|:|:...|:|:|||||||||||||||||||:|.||||..:||.|||.|||:.||.||.   
  Fly   269 WQGKLIASCCALLGISFFALPAGILGSGFALKVQQQQRQKHMIRRRQPAATLIQAVWRCYAADEH 333

Mouse   350 -------NLSRTDL-------------HSTWQYYERTVTVPMYSSQT-QTYGA------------ 381
                   |:.|..|             |:| .:..|..|:..:.||| ||.|.            
  Fly   334 SVSVATWNIHRVALPSPPASRASSSFKHNT-SFVARLPTIRRHKSQTIQTPGGGDGGGVSKPPGS 397

Mouse   382 -------SRLIPPLN----QLELLRNLKSKSGLTFRKEPQPEPSPSKGRPCRGCLCGCCPGHSSQ 435
                   :|.|..:|    .||:::|.||.:. :|.::...|.:         ||.......:||
  Fly   398 SRASTRYTRTIRDINASVENLEVVQNGKSMNP-SFSEDSVAETT---------CLKNIKNSDASQ 452

Mouse   436 KVSLKDRVFSSPRGM----------------------------AAKGKGSPQAQTV--------- 463
            ..:|.:...||..|.                            .||..||.:..|:         
  Fly   453 PATLANCKLSSSAGSLAQFPDRNRDRDQDRRGHGEGEGDQAEEQAKAGGSRRNLTIPVVLYGFLH 517

Mouse   464 -------------RRSPSADQSLD-------------------------DSPSKVPKSWSFGDRS 490
                         |.:|:.|:.|:                         ||||..|.|      .
  Fly   518 GNFLGSTLSLRNPRVAPANDRDLEAGRDEDEVHKDTCQRSNTLPLPVKPDSPSGSPGS------G 576

Mouse   491 RTRQAFRIKGAASRQNSEEASLPGE--DIV--EDNKSCNCEFVTEDLTPGLKVSIRAVCVMRFLV 551
            ||.:.|   .|||.......|.|..  |:.  ||...|.      .||...|.:||.:..:::.|
  Fly   577 RTGRFF---AAASHFLETGFSSPNPIIDVANEEDEPRCT------QLTNRHKTAIRFIRKLKYFV 632

Mouse   552 SKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRQEPLPVQSGHEQGPPGQNQAWHKGHQG 616
            ::|||||:|:||||.||:|||:|||:|:|.|:|.|..                            
  Fly   633 ARRKFKEALKPYDVKDVMEQYAAGHVDLLGRVKMLHL---------------------------- 669

Mouse   617 LGDRIDMIVGPPPPSTPRHKKYPTKGPTAPSRESPQYSPRVDQIVGRGPTITDKDRTKGPAETEL 681
               |:|.|:|             .:|    |:....|:.::                        
  Fly   670 ---RLDQILG-------------KQG----SKAKDVYASKI------------------------ 690

Mouse   682 PEDPSMMGRLGKVEKQVLSMEKKLDFLVSIYTQRMGIPPAETEAYFGAKEPEPA-PPYH--SPED 743
                |:..|:.|||:||..:|:|||.|:..|.:       :.:.:...  |.|| |..|  ||..
  Fly   691 ----SLASRVVKVERQVADIEEKLDILIKAYME-------DRDRFLAL--PLPAKPKIHSISPSH 742

Mouse   744 SRDHADKHGCIIKIVRSTS--STGQRNYAAPPAIPPAQCPPSTSWQQSHQRHGTSPVGDHGSLVR 806
            ...|...:..:|.:.:.|:  |.........|.:.|:  .|.:|..:|.....|..........:
  Fly   743 KPLHHAHNLAMIDVWKRTAALSVHPEQVTTTPLLNPS--APDSSELRSLTATQTPTTTTDAIATQ 805

Mouse   807 IPPPPAHERS--------LSAYGGGNRASTE----FLRLEGTPACRPSEAALRDSDTSISIPSVD 859
            .|.||..:.:        |::|..|:.....    ...||.    |..:........|.|.|...
  Fly   806 TPMPPHVQHTATNTKSSVLNSYQLGSEKQQHNDVFMTELEN----RTKKRVTLSLHRSTSEPYSK 866

Mouse   860 HEELERSFSGFSISQSKENLDALGSCYAAVAPCAKV-----------RPYIAEGESD------TD 907
            .|:        .|:...|..|:|.|......|.:.:           .....|||.|      .|
  Fly   867 QEQ--------RITIPDEGADSLDSSAKPTPPDSSIILIDEYEDFEEEDLNCEGEMDHFPTWEID 923

Mouse   908 SDL 910
            ||:
  Fly   924 SDI 926

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kcnq2XP_017171224.1 None
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 129/205 (63%)
Ion_trans_2 221..295 CDD:285168 48/74 (65%)
KCNQ_channel <619..719 CDD:281513 47/176 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 521 1.000 Inparanoid score I1244
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1168835at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T615259
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11537
Phylome 1 0.910 0.727 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.930

Return to query results.
Submit another query.