DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBL4B and CG10694

DIOPT Version :9

Sequence 1:NP_981957.1 Gene:UBL4B / 164153 HGNCID:32309 Length:174 Species:Homo sapiens
Sequence 2:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster


Alignment Length:177 Identity:44/177 - (24%)
Similarity:88/177 - (49%) Gaps:14/177 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     1 MFLTVKLLLGQRCSLKVSGQESVATLKRLVSR--RLKVPEEQQHLLFRGQLLEDDKHLSDYCIGP 63
            |.|::::|..:..:|:::..:.|..||:.:..  .:.:|.|...|::.|:::||...||:|.|..
  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65

Human    64 NASINVIM--QPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEPQDA---KAVLQLLRQEH-EERL 122
            : .|.|:|  :.::|.:.:|...| |.||.....::..:...|..|   :.|..|:...: ||.:
  Fly    66 D-KIIVLMGKKKVDKSSPEEKVAP-TPPLAAGPNVLRTEDVVPSLAPNDQWVSDLMSMGYGEEEV 128

Human   123 Q---KISLEHLEQLAQYLLAEEPHVEPAGERELEAKARPQSSCDMEE 166
            :   :.|..|.|:..:||:...|. |...|:.|.|....|:|..:::
  Fly   129 RSALRASFNHPERAIEYLINGIPQ-EVVSEQGLAAIPSVQTSDQLQQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBL4BNP_981957.1 UBQ 1..74 CDD:320785 20/76 (26%)
FlhF 20..>154 CDD:332151 37/144 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..174 7/26 (27%)
CG10694NP_651212.1 rad23 1..284 CDD:273167 44/177 (25%)
UBQ 1..76 CDD:294102 20/75 (27%)
UBA1_Rad23_like 110..148 CDD:270466 9/37 (24%)
XPC-binding 172..227 CDD:286376 0/3 (0%)
UBA2_Rad23_like 245..282 CDD:270467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.