DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CYP27B1 and Cyp12b2

Sequence 1:NP_000776.1 Gene:CYP27B1 HGNCID:2606 Length:508 Species:Homo sapiens
Sequence 2:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster

Alignment Length:534 Identity:133/535 (25%)
Similarity:230/535 (43%) Gaps:58/535 (11%)


Human     6 KYASRVFHR-----VRW---APELGASLGYR-----------EYHSARRSLADIPGPSTPSFLAE 51
            ||::::.:|     ..|   ...:|.:|..:           |.....||..:|||||....|:.
  Fly     3 KYSNKIIYRNVSGNQLWFNRNSSVGGTLSQQTQLELADSRIDEKWQQARSFGEIPGPSLLRMLSF 67

Human    52 LFCKGGLSRLHELQVQGAAH--FGPVWL--ASFGTVRTVYVAAPALVEELLRQEGPRPERCSFSP 112
            ....|.|...:.:|:.....  :|.::.  ...|....|:...|...|...|.||..|.|.....
  Fly    68 FMPGGALRNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFTYNPDDFEMTYRNEGVWPIRIGLES 132

Human   113 WTEHRRCR-----QRACGLLTAEGEEWQRLRSLLAPLLLRPQAAARYAGTLNNVVCDLVRRLRRQ 172
            ...:|:..     :...||.:.:|:||..:|:.:.|:|::.|...:....|:.:..:.:.:|..|
  Fly   133 LNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQ 197

Human   173 RGRGTGPPALVRDVAGEFYKFGLEGIAAVLLGSRLGCLEAQVPPDTETFIRAVGSVFVSTLLTMA 237
            |...|  ..|..|...:...:..|.|:.|.|.:|:|.|.....|:.:...:.:...|..:.....
  Fly   198 RNPET--HTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQFDV 260

Human   238 MPH-WLRHLVPGPWGRLCRDWDQMFAFAQRHVERREAEAAMRNGGQPEKDLESGAHLTHFLFREE 301
            .|. |..:...| :.:..:.:|.:......::     |.|||..|:.: |.::...|...|...:
  Fly   261 QPSIWTFYKTAG-FKKFLKTYDNITDITSNYI-----ETAMRGFGKND-DGKTKCVLEQLLEHNK 318

Human   302 LPAQSILGNVTELLLAGVDTVSNTLSWALYELSRHPEVQTALHSEITAALSPGSSAYPSATVLSQ 366
            ..|.::   |.::|:||:||.|:.....||.|:|:|..|..|..|:...|.....:...... ..
  Fly   319 KVAVTM---VMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNT-KN 379

Human   367 LPLLKAVVKEVLRLYPVVPGNSRVPDKDIHVGDYIIPKNTLVTLCHYATSRDPAQFPEPNSFRPA 431
            :|.|:|.:||.||:..:.|||.|:..||:.:..|.:|:.|.|.:.....|.|...|.:.:.|.|.
  Fly   380 MPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPE 444

Human   432 RWLGEGPTP-----------HPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEVQ--PEPG 483
            |||.....|           :||..||||||.|:|:|:|:||||::..|.::|..::|.  ||  
  Fly   445 RWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPE-- 507

Human   484 AAPVRPKTRTVLVP 497
             .|:..::..:|.|
  Fly   508 -TPIEYESTIILSP 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP27B1NP_000776.1 p450 41..505 CDD:278495 123/481 (26%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 119/468 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3707
Isobase 1 0.950 0 Normalized mean entropy S4820
OMA 1 1.010
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130162
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.