DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CYP27A1 and Cyp12b2

Sequence 1:NP_000775.1 Gene:CYP27A1 HGNCID:2605 Length:531 Species:Homo sapiens
Sequence 2:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster

Alignment Length:486 Identity:133/487 (27%)
Similarity:229/487 (47%) Gaps:32/487 (7%)


Human    52 RRQRSLEEIPRLGQLRFFFQLFVQGYALQ---LHQLQVLYKAKYGPMWM--SYLGPQMHVNLASA 111
            ::.||..|||....|| ....|:.|.||:   |.|:..|.:..||.::.  ..:|....|...:.
  Fly    48 QQARSFGEIPGPSLLR-MLSFFMPGGALRNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFTYNP 111

Human   112 PLLEQVMRQEGKYPVRNDMELWKEHRDQH--DL---TYGPFTTEGHHWYQLRQALNQRLLKPAEA 171
            ...|...|.||.:|:|..:|....:|..|  |:   ..|..:.:|..|..:|..:|..|:|....
  Fly   112 DDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKVQNV 176

Human   172 ALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPED 236
            .......:::..:|:.:|:..| ...:....:|.......:|.|:|.::....|:|.|..:...:
  Fly   177 RQNLPQLDQISKEFIDKLETQR-NPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDPN 240

Human   237 TVTFVRSIGLMFQNSLYATFLPK-WTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAA 300
            .....:.:...|..|......|. ||......:|::|..::.|.......|:..:...     ..
  Fly   241 ADRLAKHMRDFFNYSFQFDVQPSIWTFYKTAGFKKFLKTYDNITDITSNYIETAMRGF-----GK 300

Human   301 GPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEV 365
            ..|| :....|..||   :.:.:.|:..:.::||||:||||:.....||||:::|..||.|..|:
  Fly   301 NDDG-KTKCVLEQLL---EHNKKVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRREL 361

Human   366 VGVVPAGQVP-QHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHY 429
            :.::|..:.. ..::..:||.|:|.:||.||:..:.|.|.||..|::.:.|:..|:.|..:....
  Fly   362 LRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTGVLMGVL 426

Human   430 VVSRDPTAFSEPESFQPHRWLRN-------SQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQ 487
            .:|.|...|::...|.|.|||::       :.||. |.::||..:|||:|.|.|:|:||||||::
  Fly   427 ELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAA-RTRNPFVYLPFGFGPRTCIGKRIAELEIE 490

Human   488 LLLARLIQKYKVVLAPETGELKSVARIVLVP 518
            .||.||::.|||...||| .::..:.|:|.|
  Fly   491 TLLVRLLRSYKVSWLPET-PIEYESTIILSP 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP27A1NP_000775.1 p450 61..526 CDD:306555 129/478 (27%)
Sterol-binding. {ECO:0000255} 384..398 7/14 (50%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 125/465 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3707
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130162
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.