DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CYP19A1 and Cyp4d20

Sequence 1:NP_000094.2 Gene:CYP19A1 HGNCID:2594 Length:503 Species:Homo sapiens
Sequence 2:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster

Alignment Length:543 Identity:126/544 (23%)
Similarity:217/544 (40%) Gaps:128/544 (24%)


Human    26 MPVLLLTG--LFLLVWNYE---------GTSSIPGPGYCMGIGPLISHG-RFLWMG----IGSAC 74
            |.:.|:||  :.||.|::.         ..|:||||   :.| |::..| :.|.:|    ||...
  Fly     1 MWLTLITGALILLLTWDFGRKRQRVLAFEKSAIPGP---ISI-PILGCGLQALHLGAENIIGWVG 61

Human    75 NYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFN---- 135
            ..::: ||:..|.||.| |:||.:|....|..:              |....:.|||.::.    
  Fly    62 EKFDK-YGKTFRFWILG-ESLIYTKDLQYFETI--------------LSSTTLLEKGQLYEYLRP 110

Human   136 --------NNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLR 192
                    :....|...|..|..|.....|...|.:........:|.|.:|.:....||:|..:.
  Fly   111 FLNDGLLVSTGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVS 175

Human   193 RVMLDTSNTLFLRIPLDESAIVVKIQG-------YFDAWQALL-IKPDIFFKIS----WLY---- 241
            ...||.         :.|:|:.|::..       |..|.:::: |:||..|:.|    ||:    
  Fly   176 LAALDV---------ITEAAMGVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAA 231

Human   242 ----KKYEKSVKDLKDAIEVLIAEKRRRIST-------------EEKLEECMDFATELILAEKR- 288
                ::....::.:.|..:.:|:|:|..:..             :.::......|...||.:.. 
  Fly   232 PLLHRQLLSDIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSI 296

Human   289 -------GDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIG---ER 343
                   .|: ||.|:..:.|    ..||.|..:...|:.||:||.|::.|.:|:|.|:|   ..
  Fly   297 NNQPLSDADI-REEVDTFMFE----GDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASA 356

Human   344 DIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHR-LEFF 407
            .:....:|.||.::..|.|:||..|.|..:.|.|.::..|....:...|:|.|.:...|| ..:|
  Fly   357 PVTQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYF 421

Human   408 PKPNEFTLENFAKNVPYRY----FQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCV 468
            |.|..|..|.|.::....:    :.||..||:.|.|:..|::.||.::..:||.:.:..|     
  Fly   422 PDPLSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPL----- 481

Human   469 ESIQKIHDLSLHPDETKNMLEMI 491
                        .:|.|.||..|
  Fly   482 ------------GEELKPMLNFI 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP19A1NP_000094.2 p450 48..485 CDD:306555 113/503 (22%)
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 117/511 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114624407
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.