DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CYP11B2 and Cyp12b2

Sequence 1:NP_000489.3 Gene:CYP11B2 HGNCID:2592 Length:503 Species:Homo sapiens
Sequence 2:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster

Alignment Length:503 Identity:139/504 (28%)
Similarity:229/504 (45%) Gaps:60/504 (12%)


Human    19 QRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQG-YEHLHL-EMHQTFQEL-GPIFR 80
            |:||:.|                 :.||...||:|..:...| ..:.:| :|::..:|: |.|:.
  Fly    48 QQARSFG-----------------EIPGPSLLRMLSFFMPGGALRNTNLIQMNRLMREMYGDIYC 95

Human    81 Y--NLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQ-HR-------GHKCGVFLLNGP 135
            .  .:|.|..|....|:|.|...:.:.:.|.|:.||....||: ||       |   |:....|.
  Fly    96 IPGMMGKPNAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVG---GLASDQGQ 157

Human   136 EWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNAR-GSLTLDVQPSIFHYTIEA 199
            ||...|.::||.::..:.|::.||.:|.::::|...|:.:  :|.. .:||.|....:..:..|:
  Fly   158 EWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQ--RNPETHTLTTDFHNQLKMWAFES 220

Human   200 SNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKV--WKEHFEAWDC 262
            .:......|:||:..:|...:......:...|..:.|....|   |.|...|.  :|:..:.:|.
  Fly   221 ISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQFDVQP---SIWTFYKTAGFKKFLKTYDN 282

Human   263 IFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTL 327
            |.....|.|:...:....| ....|..|.|.||  |.:.:......|::....:|||:...|..|
  Fly   283 ITDITSNYIETAMRGFGKN-DDGKTKCVLEQLL--EHNKKVAVTMVMDMLMAGIDTTSSACLTIL 344

Human   328 FELARNPDVQQILRQESLAAAASISEH-PQKATTELPLLRAALKETLRLYPV--GLFLERVVSSD 389
            :.|||||..|:.||:|.|....:..:. ..:.|..:|.|||.:||.||:..:  |.|  |:...|
  Fly   345 YHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITPGNF--RITPKD 407

Human   390 LVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWL------DIR----GSGRN-FHHVPF 443
            |||..|.:|.||.|.:.:..|..:...|.:...:.|:|||      ||:    ...|| |.::||
  Fly   408 LVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPF 472

Human   444 GFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRP 491
            |||.|.|:|:|:||.|:..||..:|:.:.|..|.:..|:...:.||.|
  Fly   473 GFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETPIEYESTIILSP 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP11B2NP_000489.3 p450 42..454 CDD:278495 122/442 (28%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 130/465 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.