DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp6a22

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster

Alignment Length:509 Identity:159/510 (31%)
Similarity:258/510 (51%) Gaps:51/510 (10%)


Human    14 LLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPF-LGNILSYHKGFCMFDM-----ECHKKYGKVW 72
            ||.::|.:.:.:....:..:.:.|| |..|..| :||:..:.|.....|:     |..|..|..:
  Fly     7 LLLIALAVGFWFVRTRYSYWTRRGI-GSEPARFPVGNMEGFRKNKHFIDIVTPIYEKFKGNGAPF 70

Human    73 -GFYDGQQPVLAITDPDMIKTVLVK-----ECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRS 131
             ||:...:||:.:||.::.|.:|::     |...::.|.|.....|.:..    .:..:|:.||.
  Fly    71 AGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFR----IDGPKWRPLRQ 131

Human   132 LLSPTFTSGKLKEMVPIIAQYGDVLVR---NLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNI 193
            .:||||||.|:|.|.|.:.:.|:.|.:   .|...|..| .:.:.|:...|:.|||...:|||..
  Fly   132 KMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCG-ILEIGDLMARYTSDVIGRCAFGVEC 195

Human   194 DSLNNPQDPFVENTKKLL----RFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNF----LR 250
            :.|.||:..|....::..    ....:|.|   |..||.:...|.:..|   .:::|:|    :|
  Fly   196 NGLRNPEAEFAIMGRRAFSERRHCKLVDGF---IESFPEVARFLRMRQI---HQDITDFYVGIVR 254

Human   251 KSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLS 315
            ::||:.:|..:.     |.||:.|:|:.:...|      |:..|:.||:.||..||::|::|.|.
  Fly   255 ETVKQREEQGIV-----RSDFMNLLIEMKQRGE------LTIEEMAAQAFIFFAAGFDTSASTLG 308

Human   316 FIMYELATHPDVQQKLQEEIDAVLP-NKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKK 379
            |.:||||..|.:|.||:||||..|. :....|||::.::.|:::|:.||||.:||..:|.|:.:.
  Fly   309 FALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKYPILPQLTRISRH 373

Human   380 DVEING---MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRN 441
            .....|   .:|..|.:::||.|.:|.||..:.||.||:||||............:.|||.||||
  Fly   374 LYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPFGDGPRN 438

Human   442 CIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLK-LSLGGLLQPEKPVVLKVE 494
            ||||||..|...:.|:.:|:||.|..|..|...:: |....||.|...:.|||:
  Fly   439 CIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCPANGIYLKVQ 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 153/482 (32%)
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 152/478 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130246
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.