DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp4d14

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_001259179.1 Gene:Cyp4d14 / 45706 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster

Alignment Length:517 Identity:146/518 (28%)
Similarity:253/518 (49%) Gaps:65/518 (13%)


Human    13 LLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGN--IL---SYHKGFCMFDMECH--KKYGK 70
            :|||.:|...|:.....:.::.:.||.||...|.:||  :|   |......:|||:..  .::||
  Fly     8 ILLATALAWDYMRKRRHNKMYAEAGIRGPKSYPLVGNAPLLINESPKSKSSIFDMQFRLIAEFGK 72

Human    71 --------VWGFYDGQQPVL-AITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEW 126
                    ..||......:: ||....  :|:.....||:..|        ::...:.|::.::|
  Fly    73 NIKTQMLGESGFMTADSKMIEAIMSSQ--QTIQKNNLYSLLVN--------WLGDGLLISQGKKW 127

Human   127 KRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGV 191
            .|.|.:::|.|....|::.|.:..|....:|:.|...|:....:.:..|....:||:|..|:.||
  Fly   128 FRRRKIITPAFHFKILEDFVEVFDQQSATMVQKLYDRADGKTVINMFPVACLCAMDIIAETAMGV 192

Human   192 NIDSLNNPQDPFVEN---TKKLLRFDFLDPF-FLSITVFPFLIPILEVLNICVFPREVTNFLRKS 252
            .|::...||..:|::   ...:|...|::|. .|..|:..|...:|:.||..|  :.:.:|....
  Fly   193 KINAQLQPQFTYVQSVTTASAMLAERFMNPLQRLDFTMKLFYPKLLDKLNDAV--KNMHDFTNSV 255

Human   253 VKRMKE--------------SRLEDT-QKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIF 302
            :...:|              :.|.|. ||.|:..|.:::     |.|.....||:.::..:...|
  Fly   256 ITERRELLQKAIADGGDADAALLNDVGQKRRMALLDVLL-----KSTIDGAPLSNDDIREEVDTF 315

Human   303 IFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVL--PNKAPPTYDTVLQMEYLDMVVNETLR 365
            :|.|::||:|.::|..|.||.||:||.::.:|:..|:  ...||.|...:.:::||:.|:.|:||
  Fly   316 MFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIGDDKSAPVTMKLLGELKYLECVIKESLR 380

Human   366 LFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPY 430
            |||....:.|...:|..::|..||....|:|..|...|||.|:.:||||:|:|||.:.|..|.|:
  Fly   381 LFPSVPIIGRYISQDTVLDGKLIPADSNVIILIYHAQRDPDYFPDPEKFIPDRFSMERKGEISPF 445

Human   431 IYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLK 492
            .||||.:|||||||.:||::.||..:.:::::|...|           ||..:||...|:|:
  Fly   446 AYTPFSAGPRNCIGQKFAMLEMKSTISKMVRHFELLP-----------LGEEVQPVLNVILR 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 139/492 (28%)
Cyp4d14NP_001259179.1 p450 34..489 CDD:278495 136/483 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.