DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp6d5

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_650327.1 Gene:Cyp6d5 / 41706 FlyBaseID:FBgn0038194 Length:508 Species:Drosophila melanogaster

Alignment Length:512 Identity:163/513 (32%)
Similarity:261/513 (51%) Gaps:57/513 (11%)


Human    13 LLLAVSLVLLYLYGTHSHGLFKKLGIPGP-TPLPFLGNILSYHKGFCMFDMECHKKYGK----VW 72
            |:.||:|:.:||..|.|:  :.:.|.|.. ..:|| |.:.|..||...|.|..:..|..    |.
  Fly     7 LIAAVTLLYVYLKWTFSY--WDRKGFPSTGVSIPF-GALESVTKGKRSFGMAIYDMYKSTKEPVI 68

Human    73 GFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPF-----GPVGFMKSAISIAEDEEWKRLRSL 132
            |.|...:|.|.:.|..:...||||: ::.|.:|..:     .|   |.:::...|...|:.||:.
  Fly    69 GLYLTLRPALLVRDAQLAHDVLVKD-FASFHDRGVYVDEKNDP---MSASLFQMEGASWRALRNK 129

Human   133 LSPTFTSGKLKEMVPIIAQYGDVLVRNLRRE--AETGKPVTLKDVFGAYSMDVITSTSFGVNIDS 195
            |:|:|||||||.|.......||.||.::|::  |...|.:.||.:...|::|:|.:|.||:::||
  Fly   130 LTPSFTSGKLKAMFETSDSVGDKLVDSIRKQLPANGAKELELKKLMATYAIDIIATTIFGLDVDS 194

Human   196 LNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICV-FPREVTNFLRKSVKRMKES 259
            ..:|.:.|...:||:.|.:..|   :......||.|.||...:.: :.:|.|..:|:...|..:.
  Fly   195 FADPNNEFQIISKKVNRNNIED---IIRGTSSFLYPGLEKFFVKIGWKQEATERMRELSNRTVDL 256

Human   260 RLEDTQKHRVDFLQLMIDSQN-----------SKETESH--KALSDLELVAQSIIFIFAGYETTS 311
            | |.....|.|.|||::..:|           |.|:..:  |::|...:..|..:|..||||||:
  Fly   257 R-EQNNIVRKDLLQLLLQLRNQGKINTDDNIWSAESTKNGVKSMSKDLIAGQLFLFYVAGYETTA 320

Human   312 SVLSFIMYELATHPDVQQKLQEEI-DAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLER 375
            |..||.:|||..:|:|.:|.:|:: .|:..:....|||.:..|:||:..:.||.|.:|....|.|
  Fly   321 STTSFTLYELTQNPEVMEKAKEDVRSAIEKHGGKLTYDAISDMKYLEACILETARKYPALPLLNR 385

Human   376 VCKKDVEI--NGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSG 438
            :|.||..:  :.:.|.||..::|....:|||.:|:.:|..:.|||:.:..||.... .|.|||.|
  Fly   386 ICTKDYPVPDSKLVIQKGTPIIISLIGMHRDEEYFPDPLAYKPERYLENGKDYTQA-AYLPFGEG 449

Human   439 PRNCIGMRFALMNMKLALIRVLQNFSFKPCKE----------------TQIPLKLSL 479
            ||.|||.|...:|:|:|:.:||.||..:..||                :.:|::|||
  Fly   450 PRMCIGARMGKVNVKIAIAKVLSNFDLEIRKEKCEIEFGVYGIPLMPKSGVPVRLSL 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 154/487 (32%)
Cyp6d5NP_650327.1 p450 66..478 CDD:278495 138/421 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.