DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp9f2

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_650189.1 Gene:Cyp9f2 / 41520 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster

Alignment Length:524 Identity:179/525 (34%)
Similarity:292/525 (56%) Gaps:47/525 (9%)


Human    10 ETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILS-YHKGFCMFDMEC--HKKYG-- 69
            |.:.|.|::..|.|.:.:.::..||..||....|:.:.||:.. :.:...|||:.|  :.|.|  
  Fly     4 EFFALFAIAAALFYRWASANNDFFKDRGIAYEKPVLYFGNMAGMFLRKRAMFDIVCDLYTKGGSK 68

Human    70 KVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRR----------PFGPVGFMKSAISIAEDE 124
            |.:|.::.:||:|.:.|||:||.:.:|: :..|.|.|          |........|::....|.
  Fly    69 KFFGIFEQRQPLLMVRDPDLIKQITIKD-FDHFINHRNVFATSSDDDPHDMSNLFGSSLFSMRDA 132

Human   125 EWKRLRSLLSPTFTSGKLKEMVPIIAQYG----DVLVRNLRREAETGKPVTLKDVFGAYSMDVIT 185
            .||.:||.|||.||..|:::|..::.|..    |.|.::..|..|  ..:.:||....::.|||.
  Fly   133 RWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQE--NELDMKDYCTRFTNDVIA 195

Human   186 STSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTN-FL 249
            ||:||:.::|..:.::.|.:..|||..|.||..  :...:|..|..:.::|.:.:|.|:.|. |:
  Fly   196 STAFGLQVNSFKDRENTFYQMGKKLTTFTFLQS--MKFMLFFALKGLNKILKVELFDRKSTQYFV 258

Human   250 RKSVKRMKESRLEDTQKH---RVDFLQLMIDSQNSKETESHKA-----LSDLELVAQSIIFIFAG 306
            |..:..||.     .|:|   |.|.:.::::::...:||..||     .||.::|||..:|.|||
  Fly   259 RLVLDAMKY-----RQEHNIVRPDMINMLMEARGIIQTEKTKASAVREWSDRDIVAQCFVFFFAG 318

Human   307 YETTSSVLSFIMYELATHPDVQQKLQEEIDAV---LPNKAPPTYDTVLQMEYLDMVVNETLRLFP 368
            :||::.::.|..:||..:.||||:|.||:..|   |..| ..||:.::.|:|||.||||.||.:|
  Fly   319 FETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGK-ELTYEAIMGMKYLDQVVNEVLRKWP 382

Human   369 IAMRLERVCKKDV--EING--MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDP 429
            .|:.::|.|.||:  :::|  :.:.||.|:.:|:...||||||:..|.||.|||||.:||::|.|
  Fly   383 AAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDPKYFENPMKFDPERFSDENKESIQP 447

Human   430 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGL-LQPEKPVVLKV 493
            :.|.|||.|.|||||.||||:..|..:..:|:::.|.|.|::.|||:|...|. |.|:....:|:
  Fly   448 FTYFPFGLGQRNCIGSRFALLEAKAVIYYLLKDYRFAPAKKSCIPLELITSGFQLSPKGGFWIKL 512

Human   494 ESRD 497
            ..|:
  Fly   513 VQRN 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 169/490 (34%)
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 168/485 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 1 1.000 H111391
Inparanoid 1 1.050 277 1.000 Inparanoid score I2892
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130245
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2429
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.