DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp4p3

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster

Alignment Length:453 Identity:117/454 (26%)
Similarity:203/454 (45%) Gaps:71/454 (16%)


Human    54 HKGFCMFDMECHKKYGKVWGFY----------DGQQPVLAITDPDMIKTVLVKECYSVFTNRRPF 108
            |.|......:|.||.||.:..|          |.......:.||::|..      .:::....||
  Fly    66 HSGVFEHSRDCAKKLGKSYAEYAMGTAIYNVIDADSAERVLNDPNLINK------GTIYDFLHPF 124

Human   109 GPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKP---- 169
            ...|.:.|.     .::|...|.:|||||...       |:.|:.::.:....:..|..|.    
  Fly   125 LRTGLLTST-----GKKWHARRKMLSPTFHFN-------ILNQFQEIFITESLKFLEQFKGNDEA 177

Human   170 -VTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKL----LRFDFLDPFFLSITVFPFL 229
             ::|.:|...::::.|..|:.||.:|.:....|.:.||.:::    :| ...:|...|.|:|...
  Fly   178 IISLNEVIPRFTLNSICETAMGVKLDEMAEKGDRYRENFRQIEECFIR-RMSNPLLWSDTLFKMF 241

Human   230 -----IPILEVLNICVFPREVTNFLRKSVKRMKESR-----LED---TQKHRVDFLQLMIDSQNS 281
                 ...|:|::  .|..|:....|..:....:||     .||   |.|.|...|..:|     
  Fly   242 AEKDYASALDVVH--GFSSEIIAKRRDQLNDEIDSRGNTQTAEDELFTSKKRFAMLDTLI----- 299

Human   282 KETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPT 346
             ..|....:..:.:..:....:|.||:|||..|.|.:..::.:|:.|:|..:||.|.:.::.   
  Fly   300 -LAEKDGLIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMSLYPEEQEKCYQEIQANIDDEL--- 360

Human   347 YDTVL------QMEYLDMVVNETLRLFPIAMRLERVCKKDVEI-NGMFIPKGVVVMIPSYALHRD 404
              .:|      :::.|:..:.||:||||....:.|...::.|: ||:.:|||..:.:..:.:||:
  Fly   361 --NILNIGQLNKLKNLEYFIKETMRLFPSVPAMGRETTRETELSNGLILPKGSQIFVHVFDIHRN 423

Human   405 PKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKP 467
            |:||..||:|.||||..:|..|...|.|.||.:|.|||||.:||:..||..::.:|:.|...|
  Fly   424 PEYWDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKFAMQEMKTLMVALLKQFQILP 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 117/454 (26%)
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 117/454 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.