DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp4p2

DIOPT Version :9

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster


Alignment Length:501 Identity:112/501 - (22%)
Similarity:215/501 - (42%) Gaps:85/501 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    27 THSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMI- 90
            ||...|.|..|          .:.|.|..||..|::            .|.......:..|::| 
  Fly    73 THLRQLAKNSG----------DSYLQYSMGFSNFNV------------IDAHNAANILNHPNLIT 115

Human    91 KTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDV 155
            |.|       ::....|     |:::.:..|.:::|...||:|:.||       .:.|:.|:.::
  Fly   116 KGV-------IYNFLHP-----FLRTGVLTATEKKWHTRRSMLTRTF-------HLDILNQFQEI 161

Human   156 LVRNLRR-----EAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDF 215
            .:....:     :.:....|:|||....::::.|..|:.|:.:|.:....|.:..|      |..
  Fly   162 FIAESLKFVSQFQGQNEVVVSLKDRISRFTLNSICETAMGIKLDEMAEKGDRYRAN------FHI 220

Human   216 LDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQN 280
            :|.......|.|.      ..:.||:.....:....::|.:.|...|...|.|| .|:..::::.
  Fly   221 IDEGLTRRIVNPL------YWDDCVYNMFTGHKYNAALKVVHEFSREIIAKRRV-LLEEELENRR 278

Human   281 SKET----------------------ESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELAT 323
            :.:|                      |....:.|:.:..:....:..||:|||..|.|.:..::.
  Fly   279 ATQTADDDICVIRKKRFAMLDTLICAEKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSL 343

Human   324 HPDVQQKLQEEI-DAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEI-NGM 386
            :...|:...:|| :.:|.:.:......:.::.||...:.||:||:|....:.|...::.|: ||:
  Fly   344 YAAEQELCYQEIQEHILDDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGL 408

Human   387 FIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMN 451
            .:||...:.|..:.:||:||||..||:|.||||..:|.....||.|.||.:|.|||||.::|:..
  Fly   409 ILPKRSQINIHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQE 473

Human   452 MKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRD 497
            ||..::.:|::|...|..:.: .:...:|..|:.:..:.:|:..|:
  Fly   474 MKTLMVVILKHFKILPVIDPK-SIVFQVGITLRFKNKIKVKLVRRN 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:365848 105/483 (22%)
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 110/495 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.