DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp4e2

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster

Alignment Length:530 Identity:129/531 (24%)
Similarity:234/531 (44%) Gaps:89/531 (17%)


Human    12 WLLLAVSLVL-LYLYGTHSHGLFKKLGI----PGPTPLPFLGNILSYHKG--------FCMFDME 63
            |.:|.:.|.| |.|........|::..:    .||..||.:||.....|.        |..:   
  Fly     2 WFVLYIFLALPLLLVAYLELSTFRRRRVLNKFNGPRGLPLMGNAHQMGKNPSEILDTVFSWW--- 63

Human    64 CHKKYGK-VWGFYDGQQPVLAITDPDMIKTVLVKECY----SVFTNRRPFGPVGFMKSAISIAED 123
              .:||| .:.|:.|....:.:|....::.:|..:..    .::....|:..:|.:.|..|    
  Fly    64 --HQYGKDNFVFWIGTYSNVLVTSSKYLEFILSSQTLITKSDIYQLTHPWLGLGLLTSTGS---- 122

Human   124 EEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTS 188
             :|.:.|.:::|.|....|::...::.:.....:::|:..|........::.....::|||..|:
  Fly   123 -KWHKHRKMITPAFHFNILQDFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLDVICDTA 186

Human   189 FGVNIDSLNNPQDPFVENTK------------KLLRFDFLDPFFLSITVFPFLIPILEVLNICVF 241
            .||:|:::.|.....|:..|            .|.|.:.|   :.....:|.....|:.|     
  Fly   187 MGVSINAMENRSSSIVQAFKDMCYNINMRAFHPLKRNELL---YRLAPDYPAYSRTLKTL----- 243

Human   242 PREVTN-FLRKSVKRMKESRL------EDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQS 299
             ::.|| .:.|.::..|...:      |.|:| ::.||..::.|     |...:.|:..||..:.
  Fly   244 -QDFTNEIIAKRIEAHKSGAVSTNAGDEFTRK-KMAFLDTLLSS-----TIDGRPLNSKELYEEV 301

Human   300 IIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNK---APPTYDTVLQMEYLDMVVN 361
            ..|:|.|::||:|.:||.:|.|:.|.|.|:||.:|...|:.|.   ...|:..:.||:|||:.:.
  Fly   302 STFMFEGHDTTTSGVSFAVYLLSRHQDEQRKLFKEQREVMGNSELGRDATFQEISQMKYLDLFIK 366

Human   362 ETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDN 426
            |..|::|....:.|..:||..|:|..:|||..:.:....|..:.|.:.:|.||.||||..:..  
  Fly   367 EAQRVYPSVPFIGRFTEKDYVIDGDLVPKGTTLNLGLVMLGYNEKVFKDPHKFRPERFELEKP-- 429

Human   427 IDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVL 491
             .|:.|.||.:|||||||.:|||:.:|..:.::::||...|..:                     
  Fly   430 -GPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPALD--------------------- 472

Human   492 KVESRDGTVS 501
            ::.|:||.:|
  Fly   473 ELVSKDGYIS 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 118/489 (24%)
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 117/462 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.