DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp9b1

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster

Alignment Length:497 Identity:141/498 (28%)
Similarity:255/498 (51%) Gaps:56/498 (11%)


Human     9 METWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYG---- 69
            :|..|:||...:||:.:.|.:...|:...:....|.|||||:.:.......|..:..:.|.    
  Fly     4 VEICLVLATIGLLLFKWSTGTFKAFEGRNLYFEKPYPFLGNMAASALQKASFQKQISEFYNRTRH 68

Human    70 -KVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVG--FMKSAISIAEDEEWKRLRS 131
             |:.|.::.:.|::.|.||.:||.:.||: :..|.|.:......  .:...:::..|:.|:.:||
  Fly    69 HKLVGLFNLRTPMIQINDPQLIKKICVKD-FDHFPNHQTLNIPNERLVNDMLNVMRDQHWRNMRS 132

Human   132 LLSPTFTSGKLKEMVPIIAQYGDVLVRNLRRE-----AETGKPVTLKDVFGAYSMDVITSTSFGV 191
            :|:|.|||.|::.|..::.:.....:.:|:..     .|....:.:|.:....|.|||.:|:||:
  Fly   133 VLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGL 197

Human   192 NIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSV--- 253
            .::|.::|::.|....|.|              .|...:|.|:.: :|:...:|.||.:.::   
  Fly   198 KVNSFDDPENEFHTIGKTL--------------AFSRGLPFLKFM-MCLLAPKVFNFFKLTIFDS 247

Human   254 ------KRMKESRLEDTQKH---RVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYET 309
                  .|:....::..:||   |.|.:||:::::.    ||....:|.|:|||..||.||.:|.
  Fly   248 TNVEYFVRLVVDAMQYREKHNITRPDMIQLLMEAKK----ESKDNWTDDEIVAQCFIFFFAAFEN 308

Human   310 TSSVLSFIMYELATHPDVQQKLQEEI----DAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIA 370
            .|:::....|||..:.|:|::|.||:    :|:  ..||.|||...:|.|:|||::|:||.:.::
  Fly   309 NSNLICTTAYELLRNLDIQERLYEEVKETQEAL--KGAPLTYDAAQEMTYMDMVISESLRKWTLS 371

Human   371 MRLERVCKKDVEING-----MF-IPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDP 429
            ...:|:|.||..:..     :| ...|..:.||...||.|.:::.:|::|.|||||::.|.::.|
  Fly   372 AAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIP 436

Human   430 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKET 471
            |.|.|||.|||:|||.|:|:|..|..|..::.|:..:....|
  Fly   437 YTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASPRT 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 133/468 (28%)
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 132/463 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 277 1.000 Inparanoid score I2892
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.