DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp6w1

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_001286145.1 Gene:Cyp6w1 / 35543 FlyBaseID:FBgn0033065 Length:514 Species:Drosophila melanogaster

Alignment Length:520 Identity:160/521 (31%)
Similarity:278/521 (53%) Gaps:51/521 (10%)


Human    13 LLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGF--- 74
            |||....::.|::...:...:::.|:....|.|.:|....:......| .|..:|:.:..||   
  Fly     5 LLLGSLTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAKVPF-FEQIQKFHEAPGFENE 68

Human    75 -----YDGQQPVLAITDPDMIKTVLVKECYSVFTNR----RPFG-PVGFMKSAISIAEDEEWKRL 129
                 |...:|.|.|.|.::||||::|: :..|.||    .|.. .:|:..  :..|....|:.|
  Fly    69 PFVGVYMTHRPALVIRDLELIKTVMIKK-FQYFNNRVLQTDPHNDALGYKN--LFFARSPGWREL 130

Human   130 RSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAE---TGKPVTLKDVFGAYSMDVITSTSFGV 191
            |:.:||.|||||:|:|.|::.:.|    :||:..||   :|..|.:||:...::.|:|.:.:|||
  Fly   131 RTKISPVFTSGKIKQMYPLMVKIG----KNLQDSAERLGSGTEVQVKDLCSRFTTDLIATIAFGV 191

Human   192 NIDSLNNPQDPFVENTKKLLRFDFLDPFFLSIT-----VFPFLIPILEVL-NICVFPREVTNFLR 250
            ..::|.:.:..|..:.:.:        |.|:::     ...|:||.|..| .:.:|.||.|.|:|
  Fly   192 EANALQDAKSEFFYHNRAI--------FSLTLSRGIDFAIIFMIPALASLARVKLFSRETTKFIR 248

Human   251 KSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLE---LVAQSIIFIFAGYETTSS 312
            .||..:.:.| |.|.:.|.|.:.:::..:........|...:::   ||||:.:|..||:||::|
  Fly   249 SSVNYVLKER-ERTGEKRNDLIDILLALKREAAANPGKMSKEVDLDYLVAQAAVFQTAGFETSAS 312

Human   313 VLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVC 377
            .::..:||||.:..:|.:|::||.....::...:|:.:.:|.||..|||||||.:||...:||.|
  Fly   313 TMTMTLYELAKNEALQDRLRQEIVDFFGDEDHISYERIQEMPYLSQVVNETLRKYPIVGYIEREC 377

Human   378 KKDVE--------INGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTP 434
            .:..|        .:.|.:|.|:.:.:.:.|:||||:||.:|||:.||||:..|:||::...|.|
  Fly   378 SQPAEGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPEKYDPERFNSSNRDNLNMDAYMP 442

Human   435 FGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLS-LGGLLQPEKPVVLKVESRDG 498
            ||.|||||||||..|:..||.|:.:|:|..|..|.:|...::.: ...::..::.::|:||...|
  Fly   443 FGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTIKKIEWAPTSPVMASKRDIILRVEKVSG 507

Human   499  498
              Fly   508  507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 152/488 (31%)
Cyp6w1NP_001286145.1 p450 34..501 CDD:278495 152/484 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3658
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130151
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2429
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.