DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp4d21

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster

Alignment Length:503 Identity:132/504 (26%)
Similarity:245/504 (49%) Gaps:70/504 (14%)


Human    12 WLLLAVSLVLLYLYGTHSH-----GLFKKLGIPGPTPLPFLGNILS----YHKGFCMFDMECHKK 67
            |:||.::::::.|...:|.     ..|:|..|.||..:|.:||.|.    ..:.|.....:...|
  Fly     2 WILLGIAVLIMTLVWDNSRKQWRVNTFEKSRILGPFTIPIVGNGLQALTLRPENFIQRFGDYFNK 66

Human    68 YGKVWGFYDGQQPVLAITDPDMIKTV-----LVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWK 127
            |||.:..:...:.::...|....:::     |:|:.:.....|      .|:...:.::...:|.
  Fly    67 YGKTFRLWILGECLIYTKDLKYFESILSSSTLLKKAHLYRFLR------DFLGDGLLLSTGNKWT 125

Human   128 RLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYS---MDVITSTSF 189
            ..|.:|:|.|....|:..|.|:.:...::|..|:..|: ||  |..|:|...|   :||.|.|:.
  Fly   126 SRRKVLAPAFHFKCLENFVEIMDRNSGIMVEKLKNYAD-GK--TCVDLFKFVSLEALDVTTETAM 187

Human   190 GVNIDSLNNPQDPFVENTKKL------------LRFDFLDPFFLSITVFPFLIPILE---VLNIC 239
            ||.:::.|.|..|:.:..|.:            :|:::|         ||...|::.   ..:|.
  Fly   188 GVQVNAQNEPNFPYTKALKSVVYIESKRLASVSMRYNWL---------FPLAAPLVYRRLQKDIA 243

Human   240 VFPREVTNFLRKSVKRMKESRLEDTQ------------KHRVDFLQLMIDSQNSKETESHKALSD 292
            :........:|:....::.:|.:.|.            |.::..|.:::.:     |..:|.|||
  Fly   244 IMQDFTDKVIRERRAILERARADGTYKPLIMGDDDIGGKAKMTLLDILLQA-----TIDNKPLSD 303

Human   293 LELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVL-PN-KAPPTYDTVLQMEY 355
            :::..:..:|||||.:||:|.:|..::.::.||.||:.:.||:.:|| |: .|..|...:|:::|
  Fly   304 VDIREEVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASVTQTKLLELKY 368

Human   356 LDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERF- 419
            ||.|:.||:||.|....|.|...:|::|..:.||....:::..|.::|||:|:.:|..|.|||: 
  Fly   369 LDCVIKETMRLHPPVPILGRYIPEDLKIGEITIPGNTSILLMPYYVYRDPEYFPDPLVFKPERWM 433

Human   420 SKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKP 467
            ..|...|..|..|.||.|||:||||.:||.:.||..:.:|::::...|
  Fly   434 DMKTTSNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRHYELLP 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 124/472 (26%)
Cyp4d21NP_609129.2 p450 35..482 CDD:278495 124/471 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.