DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp4ac2

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster

Alignment Length:396 Identity:110/397 (28%)
Similarity:202/397 (51%) Gaps:24/397 (6%)


Human   113 FMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFG 177
            |:...:.|:.|::|...|..|:|.|....|:..:.|..:..:.||:.|.:  .....:.|..|..
  Fly   127 FLGEGLLISTDQKWHSRRKALTPAFHFKVLQSFLIIFKEECNKLVKVLHQ--SVNMELELNQVIP 189

Human   178 AYSMDVITSTSFGVNIDSLNN--PQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPIL--EVLNI 238
            .::::.:..|:.||.:|.|:.  .....:...:::::....:|||.:|..| ||....  :|.|:
  Fly   190 QFTLNNVCETALGVKLDDLSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYF-FLFGDYRKQVNNL 253

Human   239 CVFPREVTNFLRKSVKRMKESRL--EDT--QKHRVDFLQLMIDSQNSKETESHKALSDLELVAQS 299
            .:.....:|.:.|.....|.::|  ||.  :|.|...|..::.::...:.: |:.:.|     :.
  Fly   254 KIAHEFSSNIIEKRRSLFKSNQLGQEDEFGKKQRYAMLDTLLAAEADGQID-HQGICD-----EV 312

Human   300 IIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQ---MEYLDMVVN 361
            ..|:|.||:|||:.|.|.:..||.|.|||:|..||| ..||:.:...  :|.|   :.|::.|:.
  Fly   313 NTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEI-KYLPDDSDDI--SVFQFNELVYMECVIK 374

Human   362 ETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDN 426
            |:|||||....:.|.|.::..:||:.:||...:.|..|.:.||.::::.|:.|.|:||..:|..|
  Fly   375 ESLRLFPSVPFIGRRCVEEGVVNGLIMPKNTQINIHLYEIMRDARHFSNPKMFQPDRFFPENTVN 439

Human   427 IDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVL 491
            ..|:.:.||.:|.|||||.:||::.:|:.|..|::||...|..... .|....|.:|:.::.:.:
  Fly   440 RHPFAFVPFSAGQRNCIGQKFAILEIKVLLAAVIRNFKILPVTLLD-DLTFENGIVLRTKQNIKV 503

Human   492 KVESRD 497
            |:..|:
  Fly   504 KLVHRE 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 109/391 (28%)
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 109/391 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.