DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp309a2

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster

Alignment Length:519 Identity:138/520 (27%)
Similarity:237/520 (46%) Gaps:80/520 (15%)


Human     1 MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNI--LSYHKGFCMFDME 63
            |.::..||:   :||.:.::.:|||.|..|..::|.|:....||..||..  |...|...:||::
  Fly    32 MYILASLAL---ILLHLLVLPIYLYLTWHHKYWRKRGLVTARPLTLLGTYPGLLTRKSNLVFDVQ 93

Human    64 -CHKKY-GK--VWGFYDGQQPVLAITDPDMIKTVLVK--ECY--------------SVFTNRRPF 108
             .:.|| ||  ..|.:..:||.:.:.||::...|||.  .||              ..:....||
  Fly    94 KIYDKYKGKHRAVGVFVTRQPQILVLDPELAHEVLVSNFRCYKDSLQSSYLRHAKWDKYARLNPF 158

Human   109 GPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRRE-AETGKPVTL 172
            .           |..:.|:|||:......:..:|::...|..|.|.:|...:.:: ||....:..
  Fly   159 W-----------ASGQSWRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVAEKNNILET 212

Human   173 KDVFGAYSMDVITSTSFGVNIDSLNNPQD---PFVENTKKLLRFDFLDPFFLSITVFPFLIPILE 234
            :|:...|:..|:....:|::..:|..|.:   ...|...|...:.|   :.|::.:...:.|...
  Fly   213 RDLCFRYTAHVMADFIWGIDAGTLTRPMEQPNKVQEMASKWTSYAF---YMLTLFMATIVAPCSR 274

Human   235 -VLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQ 298
             :|....:|:|...|.....|...|.||:.....|.|:|..::..::.|:     |..| :||..
  Fly   275 LLLRFRFYPKETDEFFSNLTKESIELRLKAGDSTRTDYLSHLLQLRDQKQ-----ATHD-DLVGH 333

Human   299 SIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNET 363
            ::..:..||:|:.:.|...:|.||.:|.|||||:.||.:.:.::....::.:..::||:.|:.|:
  Fly   334 ALTVMLDGYDTSGTALLHALYYLAENPAVQQKLRVEILSCMASEKSLDFEKLSSLQYLEQVIYES 398

Human   364 LRL------------FPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLP 416
            |||            .|..:||......|||:       |:.:|||:|..|.|.:|:.|||.|.|
  Fly   399 LRLSSLIPQYTKVCTLPTVIRLSESKSLDVEV-------GMTIMIPNYQFHHDKQYFPEPEAFKP 456

Human   417 ERFSKKNKDN------IDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIP 474
            |||     ||      :...|:.||..|||.|:|:..|::.:|.||:.:|.||.....::..||
  Fly   457 ERF-----DNGAYQELMRKGIFLPFSDGPRICMGVPLAMLTLKSALVHILSNFQVVRGRDRLIP 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 126/482 (26%)
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 126/479 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.