DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp6t1

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster

Alignment Length:505 Identity:138/506 (27%)
Similarity:245/506 (48%) Gaps:54/506 (11%)


Human     1 MALIPDLAMETWLLLAVSLVLLY--LYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDME 63
            :.|:| :.:....||.|::|.|:  |:..|    :::||:|.....||:||:.:..:|.|.|..:
  Fly    17 LVLLP-VVLRGGCLLVVTIVWLWQILHFWH----WRRLGVPFVPAAPFVGNVWNLLRGACCFGDQ 76

Human    64 CHKKY------GKVW-GFYDGQQPVLAITDPDMIKTVLVKECYSVFTNR-RPFGP----VGFMKS 116
            ..:.|      |:.: |........|.:.||.:||.::|:: ::.|::| ....|    :|  ..
  Fly    77 FRELYESKEAAGRAFVGIDVLHNHALLLRDPALIKRIMVED-FAQFSSRFETTDPTCDTMG--SQ 138

Human   117 AISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRRE--AETGKPVTLKDVFGAY 179
            .:..::.|.|:....:.:|.|.:||::.|..::...|..|..::.::  ......:.:|.:...:
  Fly   139 NLFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQKLSGRDSMELEVKQLCALF 203

Human   180 SMDVITSTSFGVNIDSLNNPQDPF----VE----NTKKLLRFDFLDPFFLSITVFPFLIPILEVL 236
            :.|:|.|.:||:...||.||:..|    :|    ..|:||..         .|:| |...:...:
  Fly   204 TTDIIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPKRLLHL---------FTMF-FFPRLSHRV 258

Human   237 NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSII 301
            ...::..|...|:|||:..:...|.| :.::|.|.:.:.:..:.::..||.....|. ..||:..
  Fly   259 GTHLYSEEYERFMRKSMDYVLSQRAE-SGENRHDLIDIFLQLKRTEPAESIIHRPDF-FAAQAAF 321

Human   302 FIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPP--TYDTVLQMEYLDMVVNETL 364
            .:.||::|:||.::|.:||||.:..:|.:|:.|:.|.|.:....  :.|||..:.||..||:|.|
  Fly   322 LLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVL 386

Human   365 RLFPIAMRLERVCKKDVEI-----NG---MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSK 421
            ||:|....|:|.|......     ||   ..:..|..|.|....:|||.:||..||.|.|||||.
  Fly   387 RLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPERFSA 451

Human   422 KNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKET 471
            :.:....|..|.|||:|||.|||.....:.:|:.|:.:|.:|..:.|:.|
  Fly   452 EQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERT 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 127/466 (27%)
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 117/427 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.