DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp311a1

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_572780.3 Gene:Cyp311a1 / 32170 FlyBaseID:FBgn0030367 Length:483 Species:Drosophila melanogaster

Alignment Length:513 Identity:135/514 (26%)
Similarity:229/514 (45%) Gaps:67/514 (13%)


Human     9 METWLLLAVSLVLLYLYGTHSHGLFKKLG--IPGPTPLPFLGNILSYHK-----GFCMFDMECHK 66
            |..|.||.::|.:..|....:   ..:||  :|||...|.|||.....|     .|.:| .|...
  Fly     1 MALWPLLLITLTIWILVRKWT---LLRLGSSLPGPWAFPLLGNAQMVGKLRPEYIFLVF-TELRD 61

Human    67 KYG---------KVWGF-YDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIA 121
            ::|         ::|.| :..::...|:.||.:.|.       ..|....|.  :|   :.:.|:
  Fly    62 RFGATYRLRLGPQLWVFLHSAEETRQALHDPTLRKA-------DTFMQLEPL--IG---NGLLIS 114

Human   122 EDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITS 186
            ....|.|.|.||:|.|....|:...|.|..:.:.||..|  .|..|..:.:.:...|..:|.|..
  Fly   115 HGAHWTRQRRLLTPAFQPQLLRSFAPAIGGHVERLVGRL--GATRGAFLEVTEPLFACLLDAIVD 177

Human   187 TSFGVNIDSLNNPQDPFVEN---TKKLLRFDFLDPFFLSITVFP------FLIPILEVLNICVFP 242
            ||.|..:|:.:....|.::.   :.|||....::|...|..:|.      .|...|:|::     
  Fly   178 TSMGAQLDTQSVDHSPIIQAFHLSSKLLFKRMINPLLSSDWIFQRTQLWRDLDEQLQVIH----- 237

Human   243 REVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGY 307
            .::.:.:.|..|.:.:......:.|.      ::|:....:.|. ::||..|:..:...|:|||.
  Fly   238 SQMESVIEKRAKELLDMGEPAGRAHN------LLDTLLLAKFEG-QSLSRREIRDEINTFVFAGV 295

Human   308 ETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMR 372
            :||::.:||::|.||..|:.|.:|::|:..|..::. ...|.:..:.||:.::.|.|||:.|...
  Fly   296 DTTTAAMSFVLYALAKFPETQTRLRKELQDVALDET-TDLDALNGLPYLEALIKEVLRLYTIVPT 359

Human   373 LERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDP-YIYTPFG 436
            ..|...:..||.|.....||.:.|..|.|..|.:|:.:|..|.|||:..::.....| :.|.||.
  Fly   360 TGRQTTQSTEIGGRTYCAGVTLWINMYGLAHDKEYYPDPYAFKPERWLPEDGAVAPPAFSYIPFS 424

Human   437 SGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVE 494
            .||..|||.|::|:.|||...|:::.|..:...| |.||:|        |..:|||.:
  Fly   425 GGPHVCIGRRYSLLLMKLLTARLVREFQMELSPE-QAPLRL--------EAQMVLKAQ 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 127/479 (27%)
Cyp311a1NP_572780.3 p450 30..480 CDD:278495 127/482 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.