DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp4d2

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster

Alignment Length:481 Identity:145/482 (30%)
Similarity:251/482 (52%) Gaps:41/482 (9%)


Human    13 LLLAVSLVLL--YLYGTHSHGLFKKLGIPGPTPLPFLGNILSYH----KGFCMFDMECHKKYGKV 71
            ||:|.:.:||  :|:....:|:     :|||.|||||||:|.|.    :....|..:..:|||::
  Fly     9 LLVAFATLLLWDFLWRRRGNGI-----LPGPRPLPFLGNLLMYRGLDPEQIMDFVKKNQRKYGRL 68

Human    72 WGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVG-FMKSAISIAEDEEWKRLRSLLSP 135
            :..:...|..:..|||..|:.||..:.:  .|....:..:. ::...:.::...:|...|.:::|
  Fly    69 YRVWILHQLAVFSTDPRDIEFVLSSQQH--ITKNNLYKLLNCWLGDGLLMSTGRKWHGRRKIITP 131

Human   136 TFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQ 200
            ||....|::.|.|..|...|:|..|:..|:...|:.:..|....::|:|..|:.|..|::..||.
  Fly   132 TFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDIIAETAMGTKINAQKNPN 196

Human   201 DPFVE---NTKKLLRFDFLDPFFLSITVFPFLIP--------ILEVLNICVFPREVTNFLRKS-V 253
            .|:|:   :...:|...|:..:.....:|....|        .::|::  .|...:....|:: |
  Fly   197 LPYVQAVNDVTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAIKVMH--DFTENIIRERRETLV 259

Human   254 KRMKESRLEDT-----QKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSV 313
            ...||:..|:.     ||.|:..|.:::.|     |.....|||.::..:...|:|.|::||:|.
  Fly   260 NNSKETTPEEEVNFLGQKRRMALLDVLLQS-----TIDGAPLSDEDIREEVDTFMFEGHDTTTSA 319

Human   314 LSFIMYELATHPDVQQKLQEEIDAVL--PNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERV 376
            :||.:||::.||:|||:||:||..||  ..|:|.|...:.::::::.|:.|:|||.|....:.|.
  Fly   320 ISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESLRLHPPVPMIGRW 384

Human   377 CKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRN 441
            ..:||||.|..||.|....:..:.|.|||:|:..|::|.||||. .:...|.||.|.||.:||||
  Fly   385 FAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPDEFRPERFD-ADVPQIHPYAYIPFSAGPRN 448

Human   442 CIGMRFALMNMKLALIRVLQNFSFKP 467
            |||.:||::.||..:.::|::|...|
  Fly   449 CIGQKFAMLEMKSTVSKLLRHFELLP 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 138/454 (30%)
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 138/454 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.