DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP3A4 and Cyp6a16

DIOPT Version :8

Sequence 1:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens
Sequence 2:NP_001285631.1 Gene:Cyp6a16 / 19836250 FlyBaseID:FBgn0031726 Length:498 Species:Drosophila melanogaster

Alignment Length:514 Identity:164/515 (32%)
Similarity:255/515 (50%) Gaps:60/515 (12%)


Human     9 METWLLLAVSLVLLYL-YGTHSHGLFKKLGIPGPTPLPFLGN---ILSYHKGFCMFD-MECHKKY 68
            |:..|||..||:...| |..:....::..|||...|....|:   :.|.|....:.: .:..:..
  Fly     1 MDFTLLLLTSLLSFLLGYLRYRFTYWELRGIPQLRPHFLFGHFFRLQSVHYSELLQETYDAFRGS 65

Human    69 GKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLL 133
            .||.|.|...:|:..:.|.|::|.||::: ::.|.:||.|.......:..:: :.|||:.||:.|
  Fly    66 AKVAGTYVFLRPMAVVLDLDLVKAVLIRD-FNNFVDRRSFHGDPLTANLFNL-QGEEWRNLRTKL 128

Human   134 SPTFTSGKLKEM---VPIIAQY----GDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGV 191
            ||||||||:|.|   |..:||.    .|.||      ...|..:.|.|:...|:.|||.|.:||.
  Fly   129 SPTFTSGKMKYMFGTVSTVAQQLGGTFDELV------GSQGAVLELHDLMARYTTDVIGSCAFGT 187

Human   192 NIDSLNNPQDPF-------VENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFL 249
            ...||..||..|       ..|:.:.:|:......:|| ::....:|:.      :...::|.|.
  Fly   188 ECSSLREPQAEFRQVGRRIFRNSNRSIRWRIFKMTYLS-SLAKLGLPVR------ILHPDITKFF 245

Human   250 RKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVL 314
            .:.|:...|.| |.....|.||:.|::|   .:..|:.|.|:..::.||:.:|..||:||:||.:
  Fly   246 NRIVRETVELR-ERENIRRNDFMDLLLD---LRRQENGKGLTMEQMAAQAFVFFVAGFETSSSNM 306

Human   315 SFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKK 379
            |:.::|||.:.||||||:.||:..:......||:.:::|.|||..:.||||.:|....|.|:..:
  Fly   307 SYALFELAKNQDVQQKLRMEINDSIGKHGKLTYEAMMEMPYLDQTITETLRKYPALSSLTRLASE 371

Human   380 DVEI------NGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSG 438
            |.||      :.:.:.||..|.||..|:|.||:.:.||.:|.||||:........|..:..||.|
  Fly   372 DYEIPSPDGGDPVVLEKGTSVHIPVLAIHYDPEVYPEPHEFRPERFAPDACRERHPTAFLGFGDG 436

Human   439 PRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRD 497
            ||||||:||..|.:|:.||.:|:.|.|.                |.|..|..|||..|:
  Fly   437 PRNCIGLRFGRMQVKVGLITLLRRFRFS----------------LPPGSPTQLKVTKRN 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP3A4NP_059488.2 p450 39..493 CDD:306555 152/478 (32%)
Cyp6a16NP_001285631.1 p450 32..492 CDD:278495 154/484 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130151
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.