DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CYP2F1 and Cyp303a1

Sequence 1:XP_016881873.1 Gene:CYP2F1 HGNCID:2632 Length:573 Species:Homo sapiens
Sequence 2:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster

Alignment Length:452 Identity:115/453 (25%)
Similarity:204/453 (45%) Gaps:33/453 (7%)


Human    83 ILLLLLALVCLLLTLSSRDKGKLPPGPRPLSILGNLL----LLCSQDMLTSLTKL-SKEYGS--- 139
            ::.:..|.:..:|....|...:.||||....|:|:.|    |.|...|...:..: :::|.:   
  Fly     5 VIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG 69

Human   140 MYTVHLGPRRVVVLSGYQAVKEALVDQGEEFSGRGD--YPAFFNFTKGNGIAFSSGDRWKVLRQF 202
            .|.:.:|..:||:.....|:.|.:.:  |:..||.|  :.....|....|:..:.|:.|...|:|
  Fly    70 FYGLKIGKDKVVIAYTNDAISEMMTN--EDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRF 132

Human   203 SIQILRNFGMGKRSIEERILEEGSFLLAEL---------RKTEGEPFDPTFVLSRSVSNIICSVL 258
            .::.|:|||..:..:.:.:..|.:.||.:|         ::|..|..|.|.|.   |.|.:..:|
  Fly   133 ILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVY---VLNTLWCML 194

Human   259 FGSRFDYDDERLLTIIRLINDNFQIMSSPWGELYDIFPSLLDWVP--GPHQRIFQNFKCLRDLIA 321
            .|.|::.....:..::....:.|:.:... |.|:..||.|....|  ..:....::.:.|...::
  Fly   195 SGRRYEPGSPEITQLLETFFELFKNIDMV-GALFSHFPLLRFIAPNFSGYNGFVESHRSLYTFMS 258

Human   322 HSVHDHQASL-DPRSPRDFIQCFLTKMAEEKEDPLSHFHMDTLLMTTHNLLFGGTKTVSTTLHHA 385
            ..:..|:.:. :...|||.:..:| :..:|..|....|...:||....::...|::|.:.:|...
  Fly   259 KEIELHRLTYKNYDEPRDLMDSYL-RAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFC 322

Human   386 FLALMKYPKVQARVQEEIDLVVGRARLPA-LKDRAAMPYTDAVIHEVQRFADIIPMNLPHRVTRD 449
            |:.|:..|::|.|..:||..|||..|:|. .:||..:||.:|:..|..|...:....:|||...|
  Fly   323 FMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCD 387

Human   450 TAFRGFLIPKGTDVITLLNTVHYDPSQFLTPQEFNPEHFL-DANQSFKKSPAFMPFSAGEGR 510
            |...|:.|||.|.||.....:..:|..|..|:.|||:.:| |.:  .|...||.||..|..|
  Fly   388 TRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGH--LKLPEAFNPFGFGRHR 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP2F1XP_016881873.1 None
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 112/430 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C100971413
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.