DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp90aa1 and Hsp83

Sequence 1:NP_034610.1 Gene:Hsp90aa1 MGIID:96250 Length:733 Species:Mus musculus
Sequence 2:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster

Alignment Length:721 Identity:571/722 (79%)
Similarity:646/722 (89%) Gaps:8/722 (1%)


Mouse    15 EEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHIN 79
            ||.||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||:|.
  Fly     3 EEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIK 67

Mouse    80 LIPSKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 144
            |||:|...||||:||||||||:||:||||||||||||||||||||||||||||||||||||||||
  Fly    68 LIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 132

Mouse   145 AEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKK 209
            |:||||.:|:||||||.||||||||||||.|..||:|||||::|::|||||:||||.:|||||.|
  Fly   133 ADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNK 197

Mouse   210 HSQFIGYPITLFVEKERDKEVSDDEAEEKEEKEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGD 274
            |||||||||.|.|||||:||||||||:  :||:|..||:|.|:|: |:|||||.| |:.:|||.|
  Fly   198 HSQFIGYPIKLLVEKEREKEVSDDEAD--DEKKEGDEKKEMETDE-PKIEDVGED-EDADKKDKD 258

Mouse   275 KKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEEHLAVKHFSVEGQLEFR 339
            .||||.|||||.:.|||||||||||||||||:.|||||||||||||||:||||||||||||||||
  Fly   259 AKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFR 323

Mouse   340 ALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREML 404
            ||||:|||.|||||||:||:|||||||||||||||||:||||||||::|||||||||||||||||
  Fly   324 ALLFIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREML 388

Mouse   405 QQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTS 469
            ||:|:|||||||||||.:||..||.||||||||||:|||||:|||:||||.||.||::.||::||
  Fly   389 QQNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTS 453

Mouse   470 ASGDEMVSLKDYCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQL 534
            ||||:..||.||.:|||:||||:||||||:||||:|||||||::..|.||:||.||||||.:|.|
  Fly   454 ASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHL 518

Mouse   535 KEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCC 599
            ||::||.|||||||||||||||.||||:||.|.|||:|||:||.||:.||||||||||||.||||
  Fly   519 KEYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCC 583

Mouse   600 IVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLV 664
            ||||.:||:||||||||||||||.:||||||.||.|||||||.|:|||||||:||||||:|||||
  Fly   584 IVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLV 648

Mouse   665 ILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDP-TVDDTSAAVTEEMPPL-EGDDDTS 727
            |||:||:||||||||:.||.||:|||||||||||||||:| |.||..:|  .:.|.| |..:|.|
  Fly   649 ILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSA--GDAPSLVEDTEDAS 711

Mouse   728 RMEEVD 733
            .|||||
  Fly   712 HMEEVD 717

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp90aa1NP_034610.1 Interaction with NR3C1. {ECO:0000269|PubMed:27686098} 9..236 190/221 (86%)
PTZ00272 18..733 CDD:240341 568/717 (79%)
HATPase_c 40..191 CDD:214643 128/151 (85%)
HSP90 196..723 CDD:278607 407/529 (77%)
Interaction with NR3C1. {ECO:0000269|PubMed:27686098} 272..617 276/345 (80%)
Interaction with FLCN and FNIP1. {ECO:0000250|UniProtKB:P07900} 285..733 352/450 (78%)
Interaction with FNIP2 and TSC1. {ECO:0000250|UniProtKB:P07900} 285..621 270/336 (80%)
Interaction with NR1D1. {ECO:0000269|PubMed:27686098} 629..732 75/105 (71%)
Required for homodimerization. {ECO:0000250|UniProtKB:P07900} 683..733 32/52 (62%)
TPR repeat-binding. {ECO:0000250|UniProtKB:P07900} 724..733 6/9 (67%)
Essential for interaction with SMYD3, TSC1 and STIP1/HOP. {ECO:0000250|UniProtKB:P07900} 729..733 4/4 (100%)
Essential for interaction with SGTA and TTC1. {ECO:0000250|UniProtKB:P07900} 730..733 3/3 (100%)
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 568/717 (79%)
HATPase_c 28..179 CDD:214643 128/151 (85%)
HSP90 184..706 CDD:278607 407/528 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70468650
eggNOG 1 0.900 E1_COG0326
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1143 1.000 Inparanoid score I208
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D174605at33208
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 1 1.000 T615558
orthoMCL 1 0.900 OOG5_126623
Panther 1 1.100 O PTHR11528
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R576
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.