DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp90ab1 and Hsp83

Sequence 1:NP_032328.2 Gene:Hsp90ab1 MGIID:96247 Length:724 Species:Mus musculus
Sequence 2:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster

Alignment Length:716 Identity:564/717 (79%)
Similarity:638/717 (89%) Gaps:2/717 (0%)


Mouse    10 EEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELKID 74
            ||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.|.
  Fly     3 EEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIK 67

Mouse    75 IIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 139
            :|||....|||::||||||||:||:||||||||||||||||||||||||||||||||||||||||
  Fly    68 LIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 132

Mouse   140 AEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKK 204
            |:||.|.:|:||||||.||||||||||||||:.||:|||||::|::|||||:||||.::||:|.|
  Fly   133 ADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNK 197

Mouse   205 HSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEEDKEDEEKPKIEDVGSDEE-DDSGKDKKKK 268
            |||||||||.|.:|||||||:|||||::||.|.:|:.:.:.::|||||||.||: |...||.|||
  Fly   198 HSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDADKKDKDAKKK 262

Mouse   269 TKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALL 333
             |.|||||.:.|||||||||||||||||:||||||||||||||||||||||||||||||||||||
  Fly   263 -KTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALL 326

Mouse   334 FIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQS 398
            |||||.|||||||:||:||||||||||||||:|::||||||||::|||||||||||||||||||:
  Fly   327 FIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQQN 391

Mouse   399 KILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSG 463
            |:|||||||:|||.:||..||.||||||||||:.||||||||:||||.||.:|::.||:|||.||
  Fly   392 KVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSASG 456

Mouse   464 DEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEF 528
            |:..||::||||||:.||.:|:||||||:||:||||||||:.|||||||||||||||.:|.|||:
  Fly   457 DDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEY 521

Mouse   529 DGKSLVSVTKEGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVT 593
            .||.|||||||||||||||.||||.||.|||||:||||||.|||.|||||.:|||||.|||||||
  Fly   522 KGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCIVT 586

Mouse   594 STYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLL 658
            |.:||:||||||||||||||.:|||||..||.|||||||||||||||||:||||||||||||:||
  Fly   587 SQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVILL 651

Mouse   659 FETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRMEEV 723
            |||:||||||||:.||.|::||||||||||||||||....:.:.:..|....:|..||||.||||
  Fly   652 FETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSAGDAPSLVEDTEDASHMEEV 716

Mouse   724 D 724
            |
  Fly   717 D 717

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp90ab1NP_032328.2 Interaction with TP53. {ECO:0000250|UniProtKB:P08238} 2..527 413/518 (80%)
Interaction with BIRC2. {ECO:0000250|UniProtKB:P08238} 2..214 173/204 (85%)
Interaction with NR3C1. {ECO:0000269|PubMed:27686098} 9..231 186/221 (84%)
HSP90 14..724 CDD:332554 560/711 (79%)
Interaction with AHSA1. {ECO:0000250|UniProtKB:P08238} 215..552 261/338 (77%)
Interaction with NR3C1. {ECO:0000269|PubMed:27686098} 264..608 278/344 (81%)
Interaction with NR1D1. {ECO:0000269|PubMed:27686098} 620..723 73/103 (71%)
TPR repeat-binding 720..724 4/4 (100%)
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 561/712 (79%)
HATPase_c 28..179 CDD:214643 127/151 (84%)
HSP90 184..706 CDD:278607 399/523 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70459117
eggNOG 1 0.900 E1_COG0326
Hieranoid 1 1.000
Homologene 1 1.000 H74306
Inparanoid 1 1.050 1143 1.000 Inparanoid score I208
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D174605at33208
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 1 1.000 T615558
orthoMCL 1 0.900 OOG5_126623
Panther 1 1.100 LDO PTHR11528
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R576
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.